Méret: px
Mutatás kezdődik a ... oldaltól:



1 MTA DOKTORI ÉRTEKEZÉS Membrán transzporterek mint a gyógyszerek, növényi hatóanyagok és környezetszennyező anyagok ADMETox tulajdonságainak meghatározói Krajcsi Péter, PhD Budaörs, 2012

2 Tartalomjegyzék 1 Rövid összefoglalás Absztrakt Közlemények A dolgozat alapját képező in extenso közlemények A kandidátusi disszertációban nem szereplő további in extenso közlemények Releváns szabadalmak Scientometriai adatok A dolgozatban használt rövidítések összefoglalása Bevezetés, irodalmi áttekintés Az ADMETox és jelentősége Biológiai membránok passzív permeabilitás és transzport folyamatok Humán efflux transzporterek szerkezete, nomenklatúrája és működése Humán influx transzporterek szerkezete, nómenklatúrája és működése Efflux és influx transzporterek a farmakológiai szempontból jelentős fiziológiás membránokban Mérési módszerek xenobiotikumok permeabilitásának és transzporterekkel való kölcsönhatásának meghatározására In vitro módszerek In vivo módszerek Transzporterek jelentősége a gyógyszerek ADMETox sajátságaiban Transzporter polimorfizmusok Gyógyszerkölcsönhatások Transzporterek és növényi hatóanyagok Transzporterek toxikológiai relevanciája Célkitűzések Expressziós rendszerek optimalizálása gyógyszer transzporter kölcsönhatások vizsgálatára Tesztrendszerek korrelációs analízise, valamint transzporter szubsztrát próbák és referencia inhibitorok validálása in vitro ADME vizsgálatok céljára

3 3.3 In vitro esszérendszerek alkalmazása transzporter gyógyszer kölcsönhatások kinetikai jellemzésére In vitro esszérendszerek alkalmazása növényi hatóanyagok és környezetszennyező anyagok transzportrerekkel való kölcsönhatásának azonosítására és jellemzésére In vitro vizsgálatok in vivo relevanciájának bemutatása. In vitro in vivo korrelációs és fajspecificitás vizsgálatok Anyagok és módszerek Anyagok Sejtvonalak, tranziensen transzfektált sejtek és primer sejttenyészetek A logp és logd 7,4 számítása Fehérjetartalom meghatározása Western blot Membrán esszék Sejtes esszék In vivo esszék Eredmények Expressziós rendszerek optimalizálása gyógyszer transzporter kölcsönhatások vizsgálatára A membrán koleszterin tartalom hatása ABCG2 fehérje aktivitására A membrán koleszterin tartalom hatása ABCB11 fehérje aktivitására Transzporter szubsztrát próbák és referencia inhibitorok validálása in vitro ADME vizsgálatok céljára ABCG2 szubsztrát próbák validálása A calcein AM mint fluoreszcens ABCB1 szubsztrát próba membrán és sejtes tesztekben A CDCF mint fluorescens ABCC2 szubsztrát próba In vitro esszérendszerek alkalmazása transzporter gyógyszer kölcsönhatások kinetikai jellemzésére A seliciclib egy specifikus ABCB1 szubsztrát következményei a seliciclib ADME sajátságaira, és citotoxicitására Az ivermectin kölcsönhatása ABC transzporterekkel A sulfasalazin ABCG2 szubsztrát a kölcsönhatás jellemzése In vitro esszérendszerek alkalmazása növényi hatóanyagok és környezetszennyező anyagok transzportrerekkel való kölcsönhatásának azonosítására és jellemzésére A baicalein és a baicalein konjugátumok transzportja enterocytákban és hepatocytákban A hesperetin glükuronidok kölcsönhatása enterocyta ABC transzporterekkel

4 5.4.3 A hidroxi fahéjsavak kölcsönhatása renális anion és ABC transzporterekkel Klóracetanilid herbicidek kölcsönhatása ABC transzporterekkel In vitro vizsgálatok in vivo relevanciájának bemutatása. In vitro in vivo korrelációs és fajspecificitás vizsgálatok Az ABCC2 transzporteren mért ösztradiol 17β glükuronid transzportjának potencírozása membrán, sejtes és in vivo rendszereken A quinidin és PSC833 mint szubsztrát próba és referencia inhibitor alkalmazása vér agy gát ABCB1/Abcb1a funkció vizsgálatára Következtetések, új megállapítások Megbeszélés Köszönetnyilvánítás Referenciák

5 1 Rövid összefoglalás dc_350_ Absztrakt Az ADMETox a xenobiotikumok abszorpcióját (Absorption), disztribúcióját (Distribution), metabolizmusát (Metabolism), exkrécióját (Excretion) és toxicitását (Toxicity) tanulmányozó tudományterület. A terület fejlődésében a gyógyszeripari alkalmazások a meghatározók. Elsősorban az in vitro módszertan fejlődése valamint az in vitro in vivo extrapoláció következtében a es években mintegy ötödére csökkent a gyógyszerjelöltek klinikai fázisban történő lemorzsolódása (attrition). Munkánkat három fő irányvonal köré lehet csoportosítani: (i) új esszék/tesztrendszerek fejlesztése, mely magában foglalja az expressziós rendszer optimalizálását, szubsztrát próbák és referencia inhibitorok jellemzését, és az esszék felhasználhatósági korlátainak tanulmányozását, (ii) annak megmutatása, hogy az esszék használhatók különböző típusú xenobiotikumok (gyógyszermolekulák, növényi hatóanyagok, környezetszennyező anyagok) transzporterekkel való kölcsönhatásának jellemzésére, és ADMETox sajátságainak megértésére, (iii) valamint fajspecificitás és in vitro in vivo korrelációs vizsgálatok végzése. Legfontosabb új eredményeink: Megmutattuk, hogy az apikálisan expresszálódó efflux transzporterek aktivitása jelentősen függ az expressziós rendszer membrán koleszterin tartalmától. Kifejlesztettünk és szabadalmaztattunk egy új teszt-reagens sorozatot, a koleszterinnel feltöltött rovarsejt membránokat (High-Activity- Membrane (HAM)). Megmutattuk, hogy a molekulák lipophilicitása, valamint sejtes vizsgálatok esetében a transzporter expresszió fontos determinánsai a membrán és sejtes esszékben mért IC 50 adatoknak. Mindez felveti a barrier specifikus sejtvonalak, primer kultúrák használatának szükségességét. Megmutattuk, hogy a chlorothiazid és a teriflunomid szelektív ABCG2 szubsztrátok használhatók különböző in vitro tesztekben, és feltételezzük, hogy klinikai szubsztrát próbaként is alkalmazhatók. 5

6 Kidolgoztunk és szabadalmaztattunk egy fluoreszcens VT esszét ABCB1 transzporter gátlásának vizsgálatára. Igazoltuk, hogy a CDCF alkalmas ABCC2 szubsztrát próbaként való alkalmazásra nagy áteresztőképességű vezikuláris transzport metodikájú szűőtesztekben. Megmutattuk, hogy membrán és sejtes tesztrendszerek alkalmasak növényi hatóanyagok valamint környezeti szennyezőanyagok és konjugátumaik transzportfolyamatainak vizsgálatára. Az így kapott mechanisztikus adatok felvetik a lehetőségét a fejlesztések racionalizálásának illetve biztonságosabb peszticidek előállításának. Igazoltuk, hogy különböző komplexitású módszerek barrier -specifikus integrációjával gyógyszerek hepatikus exkréciójának és vér-agy gát penetrációjának vizsgálatával mechanisztikus és relevancia adatok egyaránt nyerhetők. Összefoglalva, vizsgálatainkat több mint két tucat szakkcikkben publikáltuk. Munkánk további eredménye két szabadalom és egy arra épülő terméklánc valamint számos új módszer. 1.2 Közlemények A dolgozat alapját képező in extenso közlemények Kis E, Ioja E, Rajnai Z, Jani M, Méhn D, Herédi-Szabó K, Krajcsi P BSEP inhibition - In vitro screens to assess cholestatic potential of drugs. TOXICOLOGY IN VITRO (2012) IF: [2.546] In Press Zhang L, Li CR, Lin G, Krajcsi P, Zuo Z Hepatic Metabolism and Disposition of Baicalein via the Coupling of Conjugation Enzymes and Transporters-In Vitro and In Vivo Evidences. AAPS JOURNAL 13:(3) pp (2011) IF: Wong CC, Barron D, Orfila C, Dionisi F, Krajcsi P, Williamson G Interaction of hydroxycinnamic acids and their conjugates with organic anion transporters and ATP-binding cassette transporters. MOLECULAR NUTRITION & FOOD RESEARCH 55:(7) pp (2011) IF: Sziraki I, Erdo F, Beery E, Molnar PM, Fazakas C, Wilhelm I, Makai I, Kis E, Heredi-Szabo K, Abonyi T, Krizbai I, Toth GK, Krajcsi P Quinidine as an ABCB1 Probe for Testing Drug Interactions at the Blood-Brain Barrier: An In Vitro In Vivo Correlation Study. JOURNAL OF BIOMOLECULAR SCREENING 16:(8) pp (2011) IF:

7 Szeremy P, Pal A, Mehn D, Toth B, Fulop F, Krajcsi P, Heredi-Szabo K Comparison of 3 Assay Systems Using a Common Probe Substrate, Calcein AM, for Studying P-gp Using a Selected Set of Compounds. JOURNAL OF BIOMOLECULAR SCREENING 16:(1) pp (2011) IF: Jani M, Makai I, Kis E, Szabo P, Nagy T, Krajcsi P, Lespine A Ivermectin Interacts With Human ABCG2. JOURNAL OF PHARMACEUTICAL SCIENCES 100:(1) pp (2011) IF: Glavinas H, von Richter O, Vojnits K, Mehn D, Wilhelm I, Nagy T, Janossy J, Krizbai I, Couraud P, Krajcsi P Calcein assay: a high-throughput method to assess P-gp inhibition. XENOBIOTICA 41:(8) pp (2011) IF: Erzsébet Beéry, Zsuzsanna Rajnai, Tibor Abonyi, Ildikó Makai, Száva Bánsághy, Franciska Erdő, István Sziráki, Krisztina Herédi-Szabó, Emese Kis, Márton Jani, János Márki-Zay, Gábor Tóth, Péter Krajcsi ABCG2 modulates chlorothiazide permeability in vitro characterization of the interaction. DRUG METABOLISM AND PHARMACOKINETICS Paper in press. (2011) IF: Brand W, Oosterhuis B, Krajcsi P, Barron D, Dionisi F, Van Bladeren P J, Rietjens I M C M, Williamson G Interaction of hesperetin glucuronide conjugates with human BCRP, MRP2 and MRP3 as detected in membrane vesicles of overexpressing baculovirus-infected Sf9 cells. BIOPHARMACEUTICS & DRUG DISPOSITION 32:(9) pp (2011) IF: Rajnai Z, Méhn D, Beéry E, Okyar A, Jani M, Tóth G K, Fülöp F, Lévi F, Krajcsi P ATP-binding cassette B1 transports seliciclib (R-roscovitine), a cyclin-dependent kinase inhibitor. DRUG METABOLISM AND DISPOSITION 38:(11) pp (2010) IF: Jemnitz K, Herédi-Szabo K, Jánossy J, Ioja E, Vereczkey L, Krajcsi P ABCC2/Abcc2: a multispecific transporter with dominant excretory functions. DRUG METABOLISM REVIEWS 42:(3) pp (2010) IF: Lespine A, Dupuy J, Alvinerie M, Comera C, Nagy T, Krajcsi P, Orlowski S Interaction of Macrocyclic Lactones with the Multidrug Transporters: The Bases of the Pharmacokinetics of Lipid-Like Drugs. CURRENT DRUG METABOLISM 10:(3) pp (2009) IF: Kis E, Rajnai Z, Ioja E, Szabo KH, Nagy T, Mehn D, Krajcsi P Mouse Bsep ATPase Assay: A Nonradioactive Tool for Assessment of the Cholestatic Potential of Drugs. JOURNAL OF BIOMOLECULAR SCREENING 14:(1) pp (2009) IF: Kis E, Nagy T, Jani M, Molnar E, Janossy J, Ujhellyi O, Nemet K, Heredi-Szabo K, Krajcsi P Leflunomide and its metabolite A are high affinity substrates of BCRP: implications for drug resistance. ANNALS OF THE RHEUMATIC DISEASES 68:(7) pp (2009) IF: Kis E, Ioja E, Nagy T, Szente L, Heredi-Szabo K, Krajcsi P Effect of Membrane Cholesterol on BSEP/Bsep Activity: Species Specificity Studies for Substrates and Inhibitors. DRUG METABOLISM AND DISPOSITION 37:(9) pp (2009) IF: Jani M, Szabó P, Kis E, Molnár É, Glavinas H, Krajcsi P Kinetic characterization of sulfasalazine transport by human ATP-binding cassette G2. BIOLOGICAL & PHARMACEUTICAL BULLETIN 32:(3) pp (2009) IF: Herédi-Szabó K, Jemnitz K, Kis E, Ioja E, Jánossy J, Vereczkey L, Krajcsi P Potentiation of MRP2/Mrp2-mediated estradiol-17 beta-glucuronide transport by drugs - A concise review. CHEMISTRY & BIODIVERSITY 6:(11) pp (2009) IF: Herédi-Szabó K, Glavinas H, Kis E, Méhn D, Báthori G, Veres Z, Kóbori L, von Richter O, Jemnitz K, Krajcsi P Multidrug resistance protein 2-mediated estradiol-17-beta-d-glucuronide transport Potentiation: in vitro-in vivo correlation and species specificity. DRUG METABOLISM AND DISPOSITION 37:(4) pp (2009) IF:

8 Oosterhuis B, Vukman K, Vági E, Glavinas H, Jablonkai I, Krajcsi P Specific interactions of chloroacetanilide herbicides with human ABC transporter proteins. TOXICOLOGY 248:(1) pp (2008) IF: Heredi-Szabo K, Kis E, Molnar E, Gyorfi A, Krajcsi P Characterization of 5(6)-carboxy-2,' 7 '-dichlorofluorescein transport by MRP2 and utilization of this substrate as a fluorescent surrogate for LTC4. JOURNAL OF BIOMOLECULAR SCREENING 13:(4) pp (2008) IF: Glavinas H, Mehn D, Jani M, Oosterhuis B, Heredi-Szabo K, Krajcsi P Utilization of membrane vesicle preparations to study drug-abc transporter interactions. EXPERT OPINION ON DRUG METABOLISM & TOXICOLOGY 4:(6) pp (2008) IF: Zhang L, Lin G, Kovacs B, Jani M, Krajcsi P, Zuo Z Mechanistic study on the intestinal absorption and disposition of baicalein. EUROPEAN JOURNAL OF PHARMACEUTICAL SCIENCES 31:(3-4) pp (2007) IF: Pal A, Mehn D, Molnar E, Gedey S, Meszaros P, Nagy T, Glavinas H, Janaky T, von Richter O, Bathori G, Szente L, Krajcsi P Cholesterol potentiates ABCG2 activity in a heterologous expression system: Improved in vitro model to study function of human ABCG2. JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS 321:(3) pp (2007) IF: Pal A, Kis E, Mehn D, Glavinas H, Nagy T, Meszaros P, Bathori G, Krajcsi P, Falkay G [In vitro methods suitable for the prediction of drug and ABC transporter, especially ABCG2 interactions]. ACTA PHARMACEUTICA HUNGARICA 77:(4) pp (2007) TT: ABC transzporterek-kulonos tekintettel az ABCG2-re-es gyogyszerjelolt molekulak: kolcsonhatasanak predikciojara alkalmas in vitro modszerek. Glavinas H, Kis E, Pál A, Kovács R, Jani M, Vági E, Molnár E, Bánsághi S, Kele Z, Janáky T, Báthori G, von Richter O, Koomen GJ, Krajcsi P ABCG2 (BCRP/MXR) ATPase assay - a useful tool to detect drug - transporter interactions. DRUG METABOLISM AND DISPOSITION 35: pp (2007) IF: Lespine A, Dupuy J, Orlowski S, Nagy T, Glavinas H, Krajcsi P, Alvinerie M Interaction of ivermectin with multidrug resistance proteins (MRP1, 2 and 3). CHEMICO-BIOLOGICAL INTERACTIONS 159:(3) pp (2006) IF: A kandidátusi disszertációban nem szereplő további in extenso közlemények von Richter O, Glavinas H, Krajcsi P, Liehner S, Siewert B, Zech K A novel screening strategy to identify ABCB1 substrates and inhibitors. NAUNYN-SCHMIEDEBERGS ARCHIVES OF PHARMACOLOGY 379:(1) pp (2009) IF: Lengyel GY, Veres ZS, Tugyi R, Vereczkey L, Molnár T, Glavinas H, Krajcsi P, Jemnitz K Modulation of sinusoidal and canalicular elimination of bilirubin-glucuronides by rifampicin and other cholestatic drugs in a sandwich culture of rat hepatocytes. HEPATOLOGY RESEARCH 38:(3) pp (2008) IF: Williamson G, Aeberli I, Miguet L, Zhang Z, Sanchez MB, Crespy V, Barron D, Needs P, Kroon PA, Glavinas H, Krajcsi P, Grigorov M Interaction of positional isomers of quercetin glucuronides with the transporter ABCC2 (cmoat, MRP2). DRUG METABOLISM AND DISPOSITION 35:(8) pp (2007) IF: Thomas M A, Lichtenstein D L, Krajcsi P, Wold W S A real-time PCR method to rapidly titer adenovirus stocks. METHODS IN MOLECULAR MEDICINE 130: pp (2007) 8

9 45.Schmitt U, Abou El-Ela A, Guo LJ, Glavinas H, Krajcsi P, Baron JM, Tillmann C, Hiemke C, Langguth P, Hartter S Cyclosporine A (CsA) affects the pharmacodynamics and pharmacokinetics of the atypical antipsychotic amisulpride probably via inhibition of P-glycoprotein (P-gp). JOURNAL OF NEURAL TRANSMISSION 113:(7) pp (2006) IF: Dorman G, Krajcsi P, Puskás L, Kovári Z, Lőrincz Z, Ürge L, Darvas F Recent Advances in Chemical Genomics. FRONTIERS IN MEDICINAL CHEMISTRY 3: pp (2006) Ying BL, Krajcsi P, Tollefson AE, Spencer JF, Doronin K, Lichtenstein DL, Wold WSM Replication-competent oncolytic adenovirus vectors that express TRAIL and over-express ADP. MOLECULAR THERAPY 9:(S1) pp. S170-S171. (2004) SU: Suppl. 1 Toth K, Djeha H, Ying BL, Tollefson AE, Kuppuswamy M, Doronin K, Krajcsi P, Lipinski K, Wrighton CJ, Wold WSM An oncolytic adenovirus vector combining enhanced cell-to-cell spreading, mediated by the ADP cytolytic protein, with selective replication in cancer cells with deregulated Wnt signaling. CANCER RESEARCH 64:(10) pp (2004) IF: GLAVINAS H, KRAJCSI P, CSEREPES J, SARKADI B The role of ABC transporters in drug resistance, metabolism and toxicity. CURRENT DRUG DELIVERY 1: pp (2004) Darvas F, Dorman G, Krajcsi P, Puskas L G, Kovari Z, Lorincz Z, Urge L Recent advances in chemical genomics. CURRENT MEDICINAL CHEMISTRY 11: pp (2004) IF: Doronin K, Toth K, Kuppuswamy M, Krajcsi P, Tollefson AE, Wold WSM Overexpression of the ADP (E3-11.6K) protein increases cell lysis and spread of adenovirus. VIROLOGY 305:(2) pp (2003) IF: Visy J, Fitos I, Mády GY, Ürge L, Krajcsi P, Simonyi M Enantioselective plasma protein binding of bimoclomol. CHIRALITY 14: pp (2002) IF: Lichtenstein DL, Krajcsi P, Esteban DJ, Tollefson AE, Wold WSM Adenovirus RID beta subunit contains a tyrosine residue that is critical for RID-mediated receptor internalization and inhibition of Fas- and TRAIL-induced apoptosis. JOURNAL OF VIROLOGY 76:(22) pp (2002) IF: Habib NA, Mitry R, Seth P, Kuppuswamy M, Doronin K, Toth K, Krajcsi P, Tollefson AE, Wold WSM Adenovirus replication-competent vectors (KD1, KD3) complement the cytotoxicity and transgene expression from replicationdefective vectors (Ad-GFP, Ad-Luc). CANCER GENE THERAPY 9:(8) pp (2002) IF: Dorman G, Krajcsi P, Ürge L, Darvas F Novel Chemical Genomics Approaches to One-Step Hit Discovery and Target Identification/Validation. PHARMACHEM 1: pp (2002) Denes L, Jednakovits A, Hargitai J, Penzes Z, Balla A, Talosi L, Krajcsi P, Csermely P Pharmacologically activated migration of aortic endothelial cells is mediated through p38 SAPK. BRITISH JOURNAL OF PHARMACOLOGY 136: pp (2002) IF: Darvas F, Szabo I, Karancsi T, Slegel P, Dorman G, Urge L, Krajcsi P Tutorial: Dual uses of in silico and in vitro metabolism data in lead discovery - ComGenex' MAID: A metabolism-alerting system for early-phase discovery research. GENETIC ENGINEERING NEWS 22: pp (2002) IF: Darvas F, Keseru GM, Papp A, Dorman G, Ürge L, Krajcsi P In Silico and Ex Silico ADME Approaches for Drug Discovery. CURRENT TOPICS IN MEDICINAL CHEMISTRY 2:(12) pp (2002) Darvas F, Dorman G, Krajcsi P, Ürge L Chemical Library Approaches to Target Validation in the Post-Genomic Era. GLOBAL OUTSOURCING REVIEW 4: pp (2002) Darvas F, Dorman G, Krajcsi P, Urge L A photoactivatable library approach for target identification and 9

10 validation.: Abstracts of Papers of the American Chemical Society. ABSTRACTS OF PAPERS OF THE AMERICAN CHEMICAL SOCIETY 223: p. B139. (2002) Doronin K, Kuppuswamy M, Toth K, Tollefson AE, Krajcsi P, Krougliak V, Wold WSM Tissue-specific, tumor-selective, replication-competent adenovirus vector for cancer gene therapy. JOURNAL OF VIROLOGY 75:(7) pp (2001) IF: Dorman G, Krajcsi P, Darvas F Chemical Library Approaches to Target Validation in the Post-Genomic Era. CURRENT DRUG DISCOVERY -: pp (2001) Balla A, Toth B, Timar G, Bak J, Krajcsi P Molecular targets for pharmacological cytoprotection. BIOCHEMICAL PHARMACOLOGY 61:(7) pp (2001) Mihalik R, Bauer P, Petak I, Krajcsi P, Marton A, Kun E, Kopper L Interaction of cytocidal drugs and the inhibition of caspase-3 by 3-nitrosobenzamide. INTERNATIONAL JOURNAL OF CANCER 82: pp (1999) IF: Krajcsi P, Wold WSM Viral proteins that regulate cellular signalling. JOURNAL OF GENERAL VIROLOGY 79: pp (1998) IF: Krajcsi P, Wold WSM Inhibition of tumor necrosis factor and interferon triggered responses by DNA viruses. SEMINARS IN CELL & DEVELOPMENTAL BIOLOGY 9:(3) pp (1998) IF: Marton A, Mihalik R, Bratincsak A, Adleff V, Petak I, Vegh M, Bauer PI, Krajcsi P Apoptotic cell death induced by inhibitors of energy conservation Bcl-2 inhibits apoptosis downstream of a fall of ATP level. EUROPEAN JOURNAL OF BIOCHEMISTRY 250:(2) pp (1997) IF: Dimitrov T, Krajcsi P, Hermiston TW, Tollefson AE, Hannink M, Wold WSM Adenovirus E3-10.4K/14.5K protein complex inhibits tumor necrosis factor-induced translocation of cytosolic phospholipase A(2) to membranes. JOURNAL OF VIROLOGY 71:(4) pp (1997) IF: Krajcsi P, Dimitrov T, Hermiston TW, Tollefson AE, Ranheim TS, VandePol SB, Stephenson AH, Wold WSM The adenovirus E3-14.7K protein and the E3-10.4K/14.5K complex of proteins, which independently inhibit tumor necrosis factor (TNF)-induced apoptosis, also independently inhibit TNF-induced release of arachidonic acid. JOURNAL OF VIROLOGY 70:(8) pp (1996) IF: Stewart AR, Tollefson AE, Krajcsi P, Yei SP, Wold WSM The Adenovirus E3 10.4K and 14.5K proteins, which function to prevent cytolysis by tumor-necrosis-factor and to down-regulate the epidermal growth-factor receptor, are localized in the plasma membrane. JOURNAL OF VIROLOGY 69:(1) pp (1995) IF: Krajcsi Péter Vírusstratégiák a gazdaszervezet immunrendszerének szuppresszálására. BIOKÉMIA 19: pp (1995) Releváns szabadalmak Bathori G.,Méhn D.,Pál Á., Krajcsi P.,Szente L., Fenyvesi É.,Telbisz Á.,Sarkadi B., Váradi A.,Gedey Sz.,Glavinas H. Test systems for transporter proteins P PCT/HU07/ May, 2006 Pál Á.,Glavinas H., Herédi Szabó K., Kis E., Krajcsi P, Mehn D., Nagy T. New vesicular transporter assay and reagent kit for the evaluation of transporter-test substance P May,

11 1.3 Scientometriai adatok dc_350_11 11

12 1.4 A dolgozatban használt rövidítések összefoglalása ABC: ATP Binding Casette (ATP-kötő kazetta) ABCB1: ABC subfamily B member 1 (ABC B alcsalád 1. tag, azonos az MDR1 illetve P-gp fehérjével) ABCG2: ABC subfamily G member 2 (ABC G alcsalád 2. tag azonos az MXR illetve BCRP fehérjével) ADME: Absorption-Distribution-Metabolism-Excretion (abszorpció-disztribúciómetabolizmus-exkréció) AUC: Area Under the Curve (görbe alatti terület) BBB: Blood Brain Barrier (vér-agy gát) 12

13 BCA: Bicinchoninic Acid (bicinkoninsav) BCRP: Breast Cancer Resistance Protein (emlőtumor rezisztencia fehérje) BCS: Biopharmaceutics Classification System (Biomolekula Klasszifikációs Rendszer) B-GS: Bimane-Glutathione (bimán-glutation) BRICII: Benign Recurrent Intrahepatic Cholestasis II (II-es típusú benignus recurrens cholestasis) BSEP: Bile Salt Export Pump (epesó export pumpa) BZB: Benzbromarone (benzbromaron) calcein-am: calcein-acetoxy-methylester (calcein-acetoximetilészter) camp: Cyclic Adenosine Monophosphate (ciklikus adenozin-monofoszfát) CDCF: Carboxy-Dichloro-Fluoreszcein (karboxi-dikloro-fluoreszcein) cgmp: Cyclic Guanosine Monophosphate (ciklikus guanozin-monofoszfát) CHO: Chinese Hamster Ovary (kinai hörcsög ovárium) CLL: Chronic Lymphocytic Leukemia (krónikus limfoid leukémia) CNS: Central Nervous System (központi idegrendszer) CsA: Cyclosporine A (cyclosporin A) CSF: Cerebrospinal Fluid (cerebrospinális folyadék) DHEAS: Dehydroepiandrosterone Sulfate (dehidroepiandroszteron-3-szulfát) DMARD: Disease Modifying Antirheumatic Drugs (Rheumatoid Arthtritis Betegségmódosító Szerek) DMSO: Dimethyl Sulfoxide (dimetil-szulfoxid) E2-17βG: Estradiol-17β-Glucuronide (ösztradiol-17 β -glükuronid) E3S: Estrone-3-Sulfate (ösztron-3-szulfát) 13

14 EMA: European Medicines Agency (Európai Gyógyszerhatóság) ER: Efflux Ratio (efflux arány) FDA: Food and Drug Administration (Amerikai Élelmiszer- és Gyógyszerhatóság) GC: Glycocholate (glikokolát) GCDC: Glycochenodeoxycholate (glikokenodeoxikolát) GlpT: Glycerol-3-Phosphate Transporter (glicerol-3-foszfát transzporter) GSH: Glutathione (redukált glutation) GSSG: Glutathione Disulfide (oxidált glutation) HBSS: Hank's Buffered Salt Solution (Hanks puffer) IVIVC: In vitro In vivo Correlation (in vitro - in vivo korreláció) LTC4: Leukotriene C4 (leukotrién C4) LY: Lucifer Yellow (Lucifer sárga) MATE1: Multidrug and Toxin Extrusion Protein 1 (multidrog és toxin extrúzió fehérje) MDCKII-BCRP: BCRP transfected Madin-Darby Canine Kidney cell line (BCRP transzfektált Madin-Darby kutya vese sejtvonal) MDCKII-MDR1: MDR1 transfected Madin-Darby Canine Kidney cell line (MDR1 transzfektált Madin-Darby kutya vese sejtvonal) MDR: Multidrug Resistance (multidrog rezisztencia) MDR1: Multridrug Resistance Protein 1 (multidrog rezisztencia fehérje 1) MSD: Mass Single Quad Detector (egyszeres quadrupole rendszerű tömegspektrométer detektor) MTX: Methotrexate (metotrexát) MXR: Mitoxantrone Resistance Protein (mitoxantron rezisztencia fehérje) 14

15 NaDC3: Sodium-ependent high affinity Dicarboxylate transporter (Nátrium függő dikarboxilát transzporter) Na/K ATPáz: sodium-potassium-atpase (Na/K ATP-áz / Na + /K + ATP-áz) NBD: Nucleotide Binding Domain (nukleotid-kötő domén) NEM-GS: N-Ethyl-Maleimide-Glutathione (N-etil-maleinimid-glutation) NHE: Sodium-proton Exchanger (Nátrium hidrogén exchanger ) NMQ: N-Methyl-Quinidine (N-metil-quinidin) OCT: Organic Cation Transporter (szerves kation transzporter) OAT: Organic Anion Transporter (szerves anion transzporter) OATP: Organic Anion Transporting Polypeptide (szerves anion transzportáló polipeptid) PAH: Para-Amino-Hyppuric Acid (para-amino-hippursav) PAMPA: Parallel Artificial Membrane Permeability Assay (parallel mesterséges membrán permeabilitás esszé) PBS: Phosphate Buffered Saline (fiziológiás foszfát puffer) PEPT: Peptide Transporter (peptid transzporter) PFICII: Progressive Familial Intrahepatic Cholestasis (II-es típusú progresszív familiális cholestais) PGE2: Prostaglandin E2 (prostaglandin E2) PGF2: Prostaglandin F2 (prostaglandin F2) P-gp: Permeability-glycoprotein (permeabilitás-glikoprotein) Pi: Inorganic Phosphate (szervetlen foszfát) POP: Persistent Organic Pollutants (perzisztáló szerves szennyezőanyagok) PPF: Peripherial Fluid (perifériás folyadék) 15

16 PT: Proximal Tubule (proximális tubulus) RBEC: Rat Brain Endothelial Culture (patkány agyi endothel kultúra) Sf9: Spodoptera frugiperda 9 cell line(spodoptera frugiperda 9 sejtvonal) SLC: Solute Carriers (oldott anyag transzporterek azonosak az influx transzporterekkel) SLCO: Solute Carrier OATP (OATP oldott anyag transzporter) SNP: Single Nucleotide Polymorphism (egypontos nukleotid polimorfizmus) SULT: Sulfotransferase TC: Taurocholate (taurokolát) TCDC: Taurochenodeoxycholate (taurokenodeoxikolát) TEER: Transepithelial Electrical Resistance (transzepitéliális elektromos ellenállás) TMD:Transmembrane Domain (transzmembrán domén) Tox: Toxicity (toxicitás) UCP: Uncoupling Protein (szétkapcsoló fehérje) Ver: Verapamil (verapamil) VT: Vesicular Transport (vezikuláris transzport) 16

17 2 Bevezetés, irodalmi áttekintés A Bevezetés, irodalmi áttekintés fejezet célja a disszertáció által lefedett terület háttérirodalmának a tárgyalása, és legfőképpen a dissszertációban tárgyalt kísérleti adatok és eredmények pozicionálása. A disszertáció alapjául szolgáló közlemények kísérletes anyaga fél tucat efflux és fél tucat influx transzportert foglal magában, melyek különböző transzporter családok tagjai. A Bevezetés, irodalmi áttekintés fejezetben elsősorban ezek kerülnek bemutatásra. A tesztelt gyógyszerek, növényi hatóanyagok és környezetszennyező anyagok, valamint az alkalmazott szubsztrát próbák és gátlószerek száma is jelentős. A kísérletes részben azoknak a vegyületeknek a bemutatására kerül sor, amelyek esetében szerkezet-hatás összefüggések tárgyalásra kerülnek. A Bevezetés, irodalmi áttekintés fejezetben az alapelveket, a szemléletmódot és a legfontosabb kutatási irányokat, kísérleti megközelítéseket igyekeztem kifejteni. Ahol az információ mennyisége megkövetelte, a tételes szakmai anyagot, példákat táblázatokba rendezve mutatom be. 2.1 Az ADMETox és jelentősége A gyógyszerkutatás és gyógyszerfejlesztés hosszadalmas és igen drága folyamat. A 90-es évekbeli statisztikák alapján a fejlesztések alatt álló hatóanyagok késői, klinikai fázisban történő lemorzsolódásának egyik fő oka (39%) a hatóanyag nem megfelelő farmakokinetikai paramétereiben keresendő (1. ábra). A farmakokinetikai sajátságok magukban foglalják azokat a tulajdonságokat, amelyek meghatározzák a gyógyszerek abszorpcióját (felszívódását/absorption), disztribúcióját (megoszlását/distribution), metabolizmusát (metabolizmus/metabolism) és exkrécióját (kiválasztását/excretion) (ADME). A disszetációban ezekre a fogalmakra a magyar szakmai nyelvben is elterjedt latin eredetű elnevezést használom, tudniillik ebben a nevezéktanban a képzett formák (pl. abszorptív, exkretórikus, stb.) egyértelműbbek. A '80-as, '90-es években végzett kutatások eredményeképpen olyan in vitro vizsgálatok kerültek kifejlesztésre, amelyek humán fehérjéket expresszáló transzfektánsok, humán szövetekből származó membrán preparátumok valamint primer, immortalizált, esetleg daganatos sejtvonalak segítségével 17

18 pontosabb előrejelzéseket tudtak készíteni a gyógyszerjelöltek várható humán ADME sajátságairól. Ennek következtében a 90-es években az előnytelen ADME miatt történő lemorzsolódás jelentősen, mintegy 8%-ra csökkent. Az említett in vitro esszék elsősorban a vegyületek metabolizmusát vizsgálták, de 1989-ben leírták a Caco-2 coloncarcinóma sejtvonalat, amely megőrizte az enterocyták differenciálódott, polarizált sajátságait, és forradalmasította az abszorpció in vitro predikcióját. A molekulák toxicitásának (Tox) in vitro vizsgálata szintén sokat fejlődött. Bár a toxicitásból fakadó lemorzsolódás növekedni látszik, ez valószínűleg a kifinomultabb toxicitás vizsgálatok, a szigorodó biztonsági előírások, és talán az in vitro ADME és hatékonysági vizsgálatok még gyorsabb fejlődése miatt miatt van így (1. ábra). 1. ábra A gyógyszerfejlesztés késői fázisaiban bekövetkező lemorzsolódás okai A növényi hatóanyagok, és bizonyos környezeti szennyezők a gyógyszerekkel részben átfedő kémiai teret foglalnak el (Eberhardt 2011). Bár jelentős időbeli lemaradással, de ezeknek az anyagoknak a tesztelése is követi a gyógyszerkutatásban megfigyelhető trendeket úgy az in vitro mint az in silico 18

19 megközelítésekben. Jól kifejezi az átfedéseket, hogy a gyógyszer étel kölcsönhatások az ADME területén már a jogi szabályozás szintjén is megjelennek. 2.2 Biológiai membránok passzív permeabilitás és transzport folyamatok Az ADME szempontból legfontosabb sejtek a polarizált epithel és endothel sejttípusok. Az endobiotikumok és xenobiotikumok ezen sejtrétegeken való átjutása lehet paracelluláris vagy transzcelluláris. A paracelluláris útvonal szoros kapcsolatokkal rendelkező sejtek esetében kisméretű molekulák számára áll rendelkezésre. Enterocyták esetében a Da moltömeg a felső határ. A transzcelluláris transzport kismolekulák esetében lehet passzív és aktív (2. ábra). A passzív transzport kétféle mechanizmus szerint valósulhat meg. A transzportermediált transzport a facilitált diffúzió, míg a nem fehérje mediált transzport a passzív diffúzió. A passzív diffúziót a gyógyszerkutatásban általában passzív permeabilitásnak nevezik, ezért én ezt a kifejezést használom. A passzív transzport folyamatok a koncentrációgrádiens mentén, a nagyobb koncentrációjú helyről a kisebb koncentrációjú hely felé történnek. Az aktív transzport folyamatok hajtóereje az ATP hidrolízis, amely lehetővé teszi a koncentráció grádienssel szembeni transzportot is. Amennyiben a transzporter maga rendelkezik ATPáz aktivitással, elsődleges aktív transzportról beszélünk. Ha az ATP hidrolízis a transzporttal funkcionálisan kapcsolt, de egy másik fehérje által mediált folyamatban történik, akkor másodlagos aktív transzportról beszélünk. A nemzetközi irodalomban több példa van arra, hogy azt a transzportot, ahol az ATP-áz és a primer transzport folyamat között egy további transzport folyamat létesít kapcsolatot, harmadlagos aktív transzportnak nevezik (Pritchard and Miller 1993; Shikano 2004; Baird 2009). 19

20 2. ábra Transzport mechanizmusok = ATP, = ADP +Pi A gyógyszerkutatás egyik legtöbbet vitatott kérdése a passzív permeabilitás és a transzporter-mediált folyamatok súlya a gyógyszermolekulák transzportjában (Dobson and Kell 2008; Dobson 2009; Sugano 2010). Hőmérséklet-függést mindkét folyamat mutat, és az aktiválási energia értékek néhány molekula esetében a passzív és aktív transzport folyamatokra hasonlóak lehetnek (Tanaka 1978; Lei 2000). Viszont a klasszikus elmélet szerint- a transzporter-mediált folyamatok telíthetők, gátolhatók, sztereospecifikusak és sejtspecifikusak, szemben a passzív permeabilitással (Sugano 2010). Kell és munkatársai szerint azonban a passzív permeabilitásnak tekintett folyamatok legtöbbjére nincs kellő bizonyíték. Még a neutrális molekulák esetében is feltételezhető, hogy a lineáris koncentrációfüggés több transzport fehérje hozzájárulásának az eredménye, míg molekulaszerkezetből adódó specificitás hiánya a transzporterek széles és átfedő szubsztrátspecificitásából eredeztethető (Dobson and Kell 2008). A szerzők rámutattak arra, hogy a molekulák szélesebb csoportjának a Caco-2 polarizált coloncarcinoma sejtvonalon és a passzív permeabilitást meghatározó PAMPA rendszerben mért permeabilitás értékei nagyon különböznek még a magas passzív permeabilitású molekulákra is (Dobson and Kell 2008). Elméletüket azzal is alátámasztják, hogy a sejtmembránok fehérjetartalma magas (30-70%), és ezek egy részét az emberi genomban kódolt közel 1000 transzporter adja ki. Utóbbi szerzők kivételként említik az altatókat, ahol a hatékonyság és a szerkezet között nincsenek összefüggések, viszont a hatékonyság 20

Tézis tárgyköréhez kapcsolódó tudományos közlemények

Tézis tárgyköréhez kapcsolódó tudományos közlemények Tézis tárgyköréhez kapcsolódó tudományos közlemények ABC transzporterek és lipidkörnyezetük kölcsönhatásának vizsgálata membrán koleszterin tartalom hatása az ABCG2 (BCRP/MXR) fehérje működésére Ph.D.


Gyógyszermolekulák és ABC transzporterek kölcsönhatásának vizsgálatára alkalmas in vitro rendszerek fejlesztése és validálása

Gyógyszermolekulák és ABC transzporterek kölcsönhatásának vizsgálatára alkalmas in vitro rendszerek fejlesztése és validálása Ph.D. értekezés tézisei Gyógyszermolekulák és ABC transzporterek kölcsönhatásának vizsgálatára alkalmas in vitro rendszerek fejlesztése és validálása Kis Emese Témavezető: Dr. Krajcsi Péter Belső konzulens:


MTA DOKTORI ÉRTEKEZÉS. Tézisek. Krajcsi Péter, PhD

MTA DOKTORI ÉRTEKEZÉS. Tézisek. Krajcsi Péter, PhD MTA DOKTORI ÉRTEKEZÉS Tézisek Krajcsi Péter, PhD Membrán transzporterek mint a gyógyszerek, növényi hatóanyagok és környezetszennyező anyagok ADMETox tulajdonságainak meghatározói Budaörs, 2012 Tartalomjegyzék


Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése

Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése Doktori tézisek Dr. Cserepes Judit Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola


Multidrog rezisztens tumorsejtek szelektív eliminálására képes vegyületek azonosítása és in vitro vizsgálata

Multidrog rezisztens tumorsejtek szelektív eliminálására képes vegyületek azonosítása és in vitro vizsgálata Multidrog rezisztens tumorsejtek szelektív eliminálására képes vegyületek azonosítása és in vitro vizsgálata Doktori értekezés tézisei Türk Dóra Témavezető: Dr. Szakács Gergely MTA TTK ENZIMOLÓGIAI INTÉZET


Az ABCG2 multidrog transzporter fehérje szerkezetének és működésének vizsgálata

Az ABCG2 multidrog transzporter fehérje szerkezetének és működésének vizsgálata Az ABCG2 multidrog transzporter fehérje szerkezetének és működésének Kutatási előzmények Az ABC transzporter membránfehérjék az ATP elhasítása (ATPáz aktivitás) révén nyerik az energiát az általuk végzett



TRANSZPORTEREK Szakács Gergely TRANSZPORTEREK Szakács Gergely Összefoglalás A biológiai membránokon keresztüli anyagáramlást számos membránfehérje szabályozza. E fehérjék változatos funkciója és megjelenésük mintázata biztosítja a sejtek


Xenobiotikum transzporterek vizsgálata humán keratinocitákban és bőrben

Xenobiotikum transzporterek vizsgálata humán keratinocitákban és bőrben DOKTORI (PHD) ÉRTEKEZÉS TÉZISEI Xenobiotikum transzporterek vizsgálata humán keratinocitákban és bőrben Bebes Attila Témavezető: Dr. Széll Márta tudományos tanácsadó Szegedi Tudományegyetem Bőrgyógyászati



VIZSGÁLATA FLOWCYTOMETRIA TERÁPIAREZISZTENCIA FEHÉRJ RJÉK K MŐKÖDÉSÉNEK M VIZSGÁLATA FLOWCYTOMETRIA ALKALMAZÁSÁVAL Szendi Eszter V. évfolyam Témavezetı: Dr. Vajdovich Péter TDK konferencia, 2008.11.26. Terápiarezisztencia alapvetı


Terápiarezisztencia-fehérjéket kódoló mrns kvantitatív kimutatása PCRtechnikával. nyirokcsomójában

Terápiarezisztencia-fehérjéket kódoló mrns kvantitatív kimutatása PCRtechnikával. nyirokcsomójában Terápiarezisztencia-fehérjéket kódoló mrns kvantitatív kimutatása PCRtechnikával lymphomás kutyák nyirokcsomójában Sunyál Orsolya V. évfolyam Témavezetık: Dr. Vajdovich Péter Szabó Bernadett SZIE-ÁOTK


A PET szerepe a gyógyszerfejlesztésben. Berecz Roland DE KK Pszichiátriai Tanszék

A PET szerepe a gyógyszerfejlesztésben. Berecz Roland DE KK Pszichiátriai Tanszék A PET szerepe a gyógyszerfejlesztésben Berecz Roland DE KK Pszichiátriai Tanszék Gyógyszerfejlesztés Felfedezés gyógyszertár : 10-15 év Kb. 1 millárd USD/gyógyszer (beleszámolva a sikertelen fejlesztéseket)





Multidrog rezisztens tumorsejtek szelektív eliminálására képes vegyületek azonosítása és in vitro vizsgálata

Multidrog rezisztens tumorsejtek szelektív eliminálására képes vegyületek azonosítása és in vitro vizsgálata Multidrog rezisztens tumorsejtek szelektív eliminálására képes vegyületek azonosítása és in vitro vizsgálata Doktori (Ph.D.) értekezés Türk Dóra Témavezető: Dr. Szakács Gergely MTA TTK ENZIMOLÓGIAI INTÉZET


NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYGENETIKA Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 A NÖVÉNYI TÁPANYAG TRANSZPORTEREK az előadás áttekintése A tápionok útja a növényben Növényi tápionok passzív és


Válasz Dr Szabó Gábor egyetemi tanár bírálatára

Válasz Dr Szabó Gábor egyetemi tanár bírálatára Válasz Dr Szabó Gábor egyetemi tanár bírálatára Válaszomban a bírálatból idézett szöveget dőlt betűvel jelöltem. A dolgozatomból idézett szöveget idézőjelek közé tettem. Köszönöm, Szabó professzornak hogy


Biobiztonság 6. Dr. Szatmári István

Biobiztonság 6. Dr. Szatmári István Biobiztonság 6. Dr. Szatmári István Pharmacokinetics and Metabolism Study of the fate of the drugs Absorption, Distribution, Metabolism and Excretion ABSORPTION: reaching the circulation after oral, transdermal,



HUMÁN ABC TRANSZPORTEREK FUNKCIONÁLIS VIZSGÁLATA. Homolya László Akadémiai doktori értekezés tézisei HUMÁN ABC TRANSZPORTEREK FUNKCIONÁLIS VIZSGÁLATA Homolya László MTA-SE Membránbiológiai Kutatócsoport Budapest, 2010. 1. Bevezetés Az ATP-Binding Cassette (ABC) transzporterek


TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK


Biológiai membránok és membrántranszport

Biológiai membránok és membrántranszport Biológiai membránok és membrántranszport Biológiai membránok A citoplazma membrán funkciói: térrészek elválasztása (egész sejt, organellumok) transzport jelátvitel Milyen a membrán szerkezete? lipidek


Szakmai önéletrajz. Tanulmányok: Tudományos minısítés:

Szakmai önéletrajz. Tanulmányok: Tudományos minısítés: Dr. Benyó Zoltán, Egyetemi Tanári Pályázat 2009, Szakmai Önéletrajz, 1. oldal Szakmai önéletrajz Név: Dr. Benyó Zoltán Születési hely, idı: Budapest, 1967. június 15. Családi állapot: nıs, 2 gyermek (Barnabás,


Biotranszformáció. Csala Miklós. Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet

Biotranszformáció. Csala Miklós. Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet Biotranszformáció Csala Miklós Semmelweis Egyetem rvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet direkt bilirubin hem (porfirin) X koleszterin X epesavak piruvát acil-koa citoplazma piruvát


7. előadás: A plazma mebrán szerkezete és funkciója. Anyagtranszport a plazma membránon keresztül.

7. előadás: A plazma mebrán szerkezete és funkciója. Anyagtranszport a plazma membránon keresztül. 7. előadás: A plazma mebrán szerkezete és funkciója. Anyagtranszport a plazma membránon keresztül. A plazma membrán határolja el az élő sejteket a környezetüktől Szelektív permeabilitást mutat, így lehetővé


repolarizációs tartalék

repolarizációs tartalék A projekt négy munkaévében, a kutatási tervben kitűzött céloknak megfelelően, az antiaritmiás és proaritmiás hatás mechanizmusában szereplő tényezők vizsgálatára került sor, amely az alábbi fontosabb új


A humán ABCB6 transzmembrán fehérje sejten belüli lokalizációjának és funkciójának tanulmányozása

A humán ABCB6 transzmembrán fehérje sejten belüli lokalizációjának és funkciójának tanulmányozása A humán ABCB6 transzmembrán fehérje sejten belüli lokalizációjának és funkciójának tanulmányozása Doktori (Ph.D.) értekezés Kiss Katalin Eötvös Loránd Tudományegyetem Természettudományi Kar Biológia Doktori


Hogyan lesznek új gyógyszereink? Bevezetés a gyógyszerkutatásba

Hogyan lesznek új gyógyszereink? Bevezetés a gyógyszerkutatásba Hogyan lesznek új gyógyszereink? Bevezetés a gyógyszerkutatásba Keserű György Miklós, PhD, DSc Magyar Tudományos Akadémia Természettudományi Kutatóközpont A gyógyszerkutatás folyamata Megalapozó kutatások





Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás.

Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Antigén felismerés Az ellenanyagok és a B sejt receptorok natív formában


Az Oxidatív stressz hatása a PIBF receptor alegységek összeszerelődésére.

Az Oxidatív stressz hatása a PIBF receptor alegységek összeszerelődésére. Újabban világossá vált, hogy a Progesterone-induced blocking factor (PIBF) amely a progesteron számos immunológiai hatását közvetíti, nem csupán a lymphocytákban és terhességgel asszociált szövetekben,


A MASP-1 dózis-függő módon vazorelaxációt. okoz egér aortában

A MASP-1 dózis-függő módon vazorelaxációt. okoz egér aortában Analog input Analog input 157.34272 167.83224 178.32175 188.81127 Relaxáció (prekontrakció %) Channel 8 Channel 8 Analog input Volts Volts Channel 12 A dózis-függő módon vazorelaxációt Vehikulum 15.80


I. Molekuláris genetikai, genom-szintű és populációgenetikai eredmények:

I. Molekuláris genetikai, genom-szintű és populációgenetikai eredmények: I. Molekuláris genetikai, genom-szintű és populációgenetikai eredmények: I.1. Epigenetikai kutatások: Elsőként sikerült feltárnunk a humán ABCC6 gén transzkripciós szabályozásának fő vonásait. Azonosítottunk



3. ANYAGOK ÉS MÓDSZEREK 1 1. BEVEZETÉS A szív- és érrendszeri kórképek után a tumoros megbetegedések képezik a második leggyakoribb halálokot világszerte. A daganatok kialakulását a kontroll nélküli sejtproliferáció és a sejthalál


térrészek elválasztása transzport jelátvitel Milyen a membrán szerkezete? Milyen a membrán szerkezete? lipid kettısréteg, hidrofil/hidrofób részek

térrészek elválasztása transzport jelátvitel Milyen a membrán szerkezete? Milyen a membrán szerkezete? lipid kettısréteg, hidrofil/hidrofób részek Biológiai membránok A citoplazma membrán funkciói: Biológiai membránok és membrántranszport térrészek elválasztása (egész sejt, organellumok) transzport jelátvitel Milyen a membrán szerkezete? lipidek


Membrán, transzport. Tankönyv 3.1 és 3.2 fejezetei. Szabó Gábor, 2016

Membrán, transzport. Tankönyv 3.1 és 3.2 fejezetei. Szabó Gábor, 2016 Membrán, transzport Tankönyv 3.1 és 3.2 fejezetei Szabó Gábor, 2016 Kulcsszavak elektrokémiai gradiens lipid-víz megoszlási hányados fogalma és jelentősége Henderson-Hasselbach egyenlet (jelentése és jelentősége


Gyógyszerek felszívódásának és agyi penetrációjának elrejelzése

Gyógyszerek felszívódásának és agyi penetrációjának elrejelzése Gyógyszerek felszívódásának és agyi penetrációjának elrejelzése Doktori tézisek Dr. Hellinger Éva Semmelweis Egyetem Gyógyszertudományi Doktori Iskola Témavezet: Konzulens: Dr. Tihanyi Károly osztályvezet,


klorid ioncsatorna az ABC (ATP Binding Casette) fehérjecsaládba tartozik, amelyek általánosságban részt vesznek a gyógyszerek olyan alapvetı

klorid ioncsatorna az ABC (ATP Binding Casette) fehérjecsaládba tartozik, amelyek általánosságban részt vesznek a gyógyszerek olyan alapvetı Szegedi Tudományegyetem Farmakológiai és Farmakoterápiai Intézet Igazgató: Prof. Dr. Varró András 6720 Szeged, Dóm tér 12., Tel.: (62) 545-682 Fax: (62) 545-680 e-mail: Opponensi



HUMÁN ABC TRANSZPORTEREK FUNKCIONÁLIS VIZSGÁLATA. Homolya László Akadémiai doktori értekezés HUMÁN ABC TRANSZPORTEREK FUNKCIONÁLIS VIZSGÁLATA Homolya László MTA-SE Membránbiológiai Kutatócsoport Budapest, 2010. "Az ember minden jel szerint arra van teremtve, hogy gondolkozzék;





3 sz. Gyógyszertudományok Doktori Program. és kurzuscím Óra

3 sz. Gyógyszertudományok Doktori Program. és kurzuscím Óra 3 sz. Gyógyszertudományok Doktori Program Kód Kurzusvezetö és kurzuscím Óra 2012-13/1 2012-13/2 2013-14/1 2013-14/2 2014-15/1 2014-15/2 0032- KV Dr. Tóthfalusi László 3208 Dr. Farsang Csaba


Témakereséstől a fejlesztési jelölt kiválasztásáig. sanofi-aventis

Témakereséstől a fejlesztési jelölt kiválasztásáig. sanofi-aventis Témakereséstől a fejlesztési jelölt kiválasztásáig sanofi-aventis A sanofi-aventis aventis számokban (2007) - First in class - Disease modifying - Personalized medicines Translational research 2 A kutatás


ERD14: egy funkcionálisan rendezetlen dehidrin fehérje szerkezeti és funkcionális jellemzése

ERD14: egy funkcionálisan rendezetlen dehidrin fehérje szerkezeti és funkcionális jellemzése Doktori értekezés tézisei ERD14: egy funkcionálisan rendezetlen dehidrin fehérje szerkezeti és funkcionális jellemzése DR. SZALAINÉ ÁGOSTON Bianka Ildikó Témavezetők Dr. PERCZEL András egyetemi tanár és


rso vvt ghost hipotónia normotónia iso

rso vvt ghost hipotónia normotónia iso Membrán, transzport rso vvt ghost hipotónia normotónia iso ~50 membrán fehérje mutáció megváltozott morfológia Figure 4. Red cell morphology. Hereditary spherocytosis (HS; top panel); nonhemolytic hereditary


Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 3. előadás Az immunrendszer molekuláris elemei: antigén, ellenanyag, Ig osztályok Az antigén meghatározása Detre László: antitest generátor - Régi meghatározás:


Leukotriénekre ható molekulák. Eggenhofer Judit OGYÉI-OGYI

Leukotriénekre ható molekulák. Eggenhofer Judit OGYÉI-OGYI Leukotriénekre ható molekulák Eggenhofer Judit OGYÉI-OGYI Mik is azok a leukotriének? Honnan ered az elnevezésük? - először a leukocitákban mutatták ki - kémiai szerkezetükből vezethető le - a konjugált


PROGRAM. Dizájner drogok a feketepiacon kihívások a lefoglalt anyagok azonosításában

PROGRAM. Dizájner drogok a feketepiacon kihívások a lefoglalt anyagok azonosításában PROGRAM 2016. április 6. (szerda) 11.00 Regisztráció 12.50 Megnyitó Monostory Katalin, a Szimpózium elnöke S1 13.00 Nyitó előadás Elnök: Vastag Monika, Monostory Katalin S1 1 13.00 Szántay Csaba, Béni


Glukuronidtranszport az endoplazmás retikulumban

Glukuronidtranszport az endoplazmás retikulumban Glukuronidtranszport az endoplazmás retikulumban Doktori értekezés Dr. Révész Katalin Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola Témavezető: Dr. Csala Miklós egyetemi docens, Ph.D. Hivatalos


Dr. Dinya Elek egyetemi tanár

Dr. Dinya Elek egyetemi tanár GYÓGYSZERKINETIKAI VIZSGÁLATOK STATISZTIKAI ALAPJAI Dr. Dinya Elek egyetemi tanár Semmelweis Egyetem Doktori Iskola 2015. április 30. Gyógyszerek: mi segít az adagolás kiszámításában? Klinikai farmakokinetika:



OZMÓZIS, MEMBRÁNTRANSZPORT OZMÓZIS, MEMBRÁNTRANSZPORT Vig Andrea PTE ÁOK Biofizikai Intézet 2014.10.28. ÁTTEKINTÉS DIFFÚZIÓ BROWN-MOZGÁS a részecskék rendezetlen hőmozgása DIFFÚZIÓ a részecskék egyenletlen (inhomogén) eloszlásának



MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A BIOLÓGIAI MEMBRÁNOK 1. kulcsszó cím: MEMBRÁNOK Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA A BIOLÓGIAI MEMBRÁNOK 1. kulcsszó cím: MEMBRÁNOK A membránok minden sejtnek lényeges alkotórészei. Egyrészt magát a sejtet határolják - ez a sejtmembrán vagy


RÉSZLETES BESZÁMOLÓ Az OTKA által támogatott konzorcium működésében az Uzsoki utcai Kórház feladata a szövetminták gyűjtése, előzetes feldolgozása, ill. a betegek utánkövetése, valamint az utánkövétésre


Kémiai biológia avagy mit nyújt(hat) a kémia az élettudományoknak

Kémiai biológia avagy mit nyújt(hat) a kémia az élettudományoknak A Magyar Tudomány Ünnepe 2007 Kémiai biológia avagy mit nyújt(hat) a kémia az élettudományoknak Tudományos ülésszak A Debreceni Egyetem Természettudományi Karának Kémiai Intézete és A Debreceni Akadémiai


PROGRAM. S.1 14.05 17.50 Klasszikus és nem klasszikus farmakokinetikai vizsgálatok Elnök: Kapás Margit, Tóthfalusi László

PROGRAM. S.1 14.05 17.50 Klasszikus és nem klasszikus farmakokinetikai vizsgálatok Elnök: Kapás Margit, Tóthfalusi László PROGRAM 2014. április 23. (szerda) 12.00 Regisztráció 14.00 Megnyitó Monostory Katalin, a Szimpózium elnöke S.1 14.05 17.50 Klasszikus és nem klasszikus farmakokinetikai vizsgálatok Elnök: Kapás Margit,


Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői.

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői. Immunológia alapjai 3 4. előadás Az immunológiai felismerés molekuláris összetevői. Az antigén fogalma. Antitestek, T- és B- sejt receptorok: molekuláris szerkezet, funkciók, alcsoportok Az antigén meghatározása



ABC TRANSZPORTEREK ÚTON ÚTFÉLEN ABC TRANSZPORTEREK ÚTON ÚTFÉLEN MTA TTK, Molekuláris Farmakológiai Intézet, Molekuláris Sejtbiológiai Laboratórium, Budapest Összefoglalás A különböző ABC transzporterek igen fontos szerepet látnak el


ZSÍRSAVAK OXIDÁCIÓJA. FRANZ KNOOP német biokémikus írta le először a mechanizmusát. R C ~S KoA. a, R-COOH + ATP + KoA R C ~S KoA + AMP + PP i

ZSÍRSAVAK OXIDÁCIÓJA. FRANZ KNOOP német biokémikus írta le először a mechanizmusát. R C ~S KoA. a, R-COOH + ATP + KoA R C ~S KoA + AMP + PP i máj, vese, szív, vázizom ZSÍRSAVAK XIDÁCIÓJA FRANZ KNP német biokémikus írta le először a mechanizmusát 1 lépés: a zsírsavak aktivációja ( a sejt citoplazmájában, rövid zsírsavak < C12 nem aktiválódnak)


Eredeti gyógyszerkutatás

Eredeti gyógyszerkutatás Eredeti gyógyszerkutatás ELTE TTK vegyészhallgatók számára Dr Arányi Péter 2009 március, 3.ea. A molekuláris célpont kiválasztása; szűrővizsgálati rendszerek 1 How do we proceed? New target Internal Literature


Kevéssé fejlett, sejthártya betüremkedésekből. Citoplazmában, cirkuláris DNS, hisztonok nincsenek

Kevéssé fejlett, sejthártya betüremkedésekből. Citoplazmában, cirkuláris DNS, hisztonok nincsenek 1 A sejtek felépítése Szerkesztette: Vizkievicz András A sejt az élővilág legkisebb, önálló életre képes, minden életjelenséget mutató szerveződési egysége. Minden élőlény sejtes szerveződésű, amelyek


Hús és hústermék, mint funkcionális élelmiszer

Hús és hústermék, mint funkcionális élelmiszer Hús és hústermék, mint funkcionális élelmiszer Szilvássy Z., Jávor A., Czeglédi L., Csiki Z., Csernus B. Debreceni Egyetem Funkcionális élelmiszer Első használat: 1984, Japán speciális összetevő feldúsítása


A sejtfelszíni FasL és szolubilis vezikulakötött FasL által indukált sejthalál gátlása és jellemzése

A sejtfelszíni FasL és szolubilis vezikulakötött FasL által indukált sejthalál gátlása és jellemzése A sejtfelszíni FasL és szolubilis vezikulakötött FasL által indukált sejthalál gátlása és jellemzése Doktori értekezés tézisei Hancz Anikó Témavezetők: Prof. Dr. Sármay Gabriella Dr. Koncz Gábor Biológia


A humán ABCG2 fehérje dimerizációjának tanulmányozása pontmutánsok segítségével

A humán ABCG2 fehérje dimerizációjának tanulmányozása pontmutánsok segítségével A humán ABCG2 fehérje dimerizációjának tanulmányozása pontmutánsok segítségével Doktori értekezés Dr. Polgár Orsolya Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola Témavezető: Dr. Váradi


MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben Modul cím: MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben Tartalék energiaforrás, membránstruktúra alkotása, mechanikai


A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban

A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban Doktori (PhD) értekezés Siklódi Erika Rozália Biológia Doktori Iskola Iskolavezető: Prof. Erdei Anna, tanszékvezető egyetemi


Egy idegsejt működése

Egy idegsejt működése 2a. Nyugalmi potenciál Egy idegsejt működése A nyugalmi potenciál (feszültség) egy nem stimulált ingerelhető sejt (neuron, izom, vagy szívizom sejt) membrán potenciálját jelenti. A membránpotenciál a plazmamembrán


Racionális gyógyszerfejlesztés

Racionális gyógyszerfejlesztés Racionális gyógyszerfejlesztés Bölcskei Kata Pécsi Tudományegyetem Farmakológiai és Farmakoterápiai Intézet KLINIKAI FARMAKOLÓGIA gyógyszerek hatásainak tanulmányozása humán vizsgálatokban 1. forgalomban


1. Bevezetés. Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei

1. Bevezetés. Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei 1. Bevezetés Mi az élet, evolúció, információ és energiaáramlás, a szerveződés szintjei 1.1 Mi az élet? Definíció Alkalmas legyen különbségtételre élő/élettelen közt Ne legyen túl korlátozó (más területen


Fehérjeglikoziláció az endoplazmás retikulumban mint lehetséges daganatellenes támadáspont

Fehérjeglikoziláció az endoplazmás retikulumban mint lehetséges daganatellenes támadáspont Fehérjeglikoziláció az endoplazmás retikulumban mint lehetséges daganatellenes támadáspont Doktori tézisek Dr. Konta Laura Éva Semmelweis Egyetem Molekuláris Orvostudományok Tudományági Doktori Iskola


Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az



SEMMELWEIS EGYETEM GYÓGYSZERTUDOMÁNYOK DOKTORI ISKOLA TARTALOMJEGYZÉK SEMMELWEIS EGYETEM GYÓGYSZERTUDOMÁNYOK DOKTORI ISKOLA A bilirubin konjugációjának és a konjugátumok transzport folyamatainak tanulmányozása primer kollagén szendvics és hagyományos rigid


Kutatási beszámoló ( )

Kutatási beszámoló ( ) Kutatási beszámoló (2008-2012) A thrombocyták aktivációja alapvető jelentőségű a thrombotikus betegségek kialakulása szempontjából. A pályázat során ezen aktivációs folyamatok mechanizmusait vizsgáltuk.


2. Ismert térszerkezetű transzmembrán fehérjék adatbázisa: a PDBTM adatbázis. 3. A transzmembrán fehérje topológiai adatbázis, a TOPDB szerver

2. Ismert térszerkezetű transzmembrán fehérjék adatbázisa: a PDBTM adatbázis. 3. A transzmembrán fehérje topológiai adatbázis, a TOPDB szerver A 2005 és 2007 között megvalósított project célja transzmembrán fehérjék vizsgálata és az ehhez szükséges eljárások kifejlesztése volt. Ez utóbbi magába foglalta új adatbázisok és szerkezet becslő módszerek


Az aminoxidázok és a NADPH-oxidáz szerepe az ér- és neuronkárosodások kialakulásában (patomechanizmus és gyógyszeres befolyásolás)

Az aminoxidázok és a NADPH-oxidáz szerepe az ér- és neuronkárosodások kialakulásában (patomechanizmus és gyógyszeres befolyásolás) Az aminoxidázok és a NADPH-oxidáz szerepe az ér- és neuronkárosodások kialakulásában (patomechanizmus és gyógyszeres befolyásolás) Az aminoxidázok két nagy csoportjának, a monoamin-oxidáznak (MAO), valamint


Tóth István Balázs személyi adatai és szakmai önéletrajza

Tóth István Balázs személyi adatai és szakmai önéletrajza Személyi adatok Tóth István Balázs személyi adatai és szakmai önéletrajza Név: Tóth István Balázs Születési hely, idő: Debrecen, 1978. december 30. Családi állapot: nős, két gyermek édesapja Szakmai önéletrajz


Vezikuláris transzport

Vezikuláris transzport Molekuláris Sejtbiológia Vezikuláris transzport Dr. habil KŐHIDAI László Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet 2005. november 3. Intracelluláris vezikul uláris transzport Kommunikáció


Integráció. Csala Miklós. Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet

Integráció. Csala Miklós. Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet Integráció Csala Miklós Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet Anyagcsere jóllakott állapotban Táplálékkal felvett anyagok sorsa szénhidrátok fehérjék lipidek


Gyógyszerek célba juttatása

Gyógyszerek célba juttatása ALKIMIA MA 2008. oktober 2 Gyógyszerek célba juttatása Hudecz Ferenc Eötvös Loránd Tudományegyetem, Szerves kémiai Tanszék MTA-ELTE Peptidkémiai Kutatócsoport, Budapest Paul Ehrlich 1854-1915 (Wellcome



TRANSZPORTFOLYAMATOK A SEJTEKBEN 16 A sejtek felépítése és mûködése TRANSZPORTFOLYAMATOK A SEJTEKBEN 1. Sejtmembrán elektronmikroszkópos felvétele mitokondrium (energiatermelõ és lebontó folyamatok) citoplazma (fehérjeszintézis, anyag


Hatóanyag-tartalmú peptid-konjugátumok előállítása és in vitro tumorellenes hatása

Hatóanyag-tartalmú peptid-konjugátumok előállítása és in vitro tumorellenes hatása ORBÁN ERIKA Hatóanyag-tartalmú peptid-konjugátumok előállítása és in vitro tumorellenes hatása DOKTORI ÉRTEKEZÉS TÉZISEI Témavezető: Dr. Hudecz Ferenc tanszékvezető egyetemi tanár, kutatócsoport vezető,


K68464 OTKA pályázat szakmai zárójelentés

K68464 OTKA pályázat szakmai zárójelentés K68464 OTKA pályázat szakmai zárójelentés A fehérjeaggregáció és amiloidképződés szerkezeti alapjai; a különféle morfológiájú aggregátumok kialakulásának körülményei és in vivo hatásuk vizsgálata Vezető


folsav, (a pteroil-glutaminsav vagy B 10 vitamin) dihidrofolsav tetrahidrofolsav N CH 2 N H H 2 N COOH

folsav, (a pteroil-glutaminsav vagy B 10 vitamin) dihidrofolsav tetrahidrofolsav N CH 2 N H H 2 N COOH folsav, (a pteroil-glutaminsav vagy B 10 vitamin) 2 2 2 2 pirimidin rész pirazin rész aminobenzoesav rész glutaminsav rész pteridin rész dihidrofolsav 2 2 2 2 tetrahidrofolsav 2 2 2 2 A dihidrofolát-reduktáz


DER (Felületén riboszómák találhatók) Feladata a biológiai fehérjeszintézis Riboszómák. Az endoplazmatikus membránrendszer. A kódszótár.

DER (Felületén riboszómák találhatók) Feladata a biológiai fehérjeszintézis Riboszómák. Az endoplazmatikus membránrendszer. A kódszótár. Az endoplazmatikus membránrendszer Részei: DER /durva (szemcsés) endoplazmatikus retikulum/ SER /sima felszínű endoplazmatikus retikulum/ Golgi készülék Lizoszómák Peroxiszómák Szekréciós granulumok (váladékszemcsék)


A légzési lánc és az oxidatív foszforiláció

A légzési lánc és az oxidatív foszforiláció A légzési lánc és az oxidatív foszforiláció Csala Miklós Semmelweis Egyetem Orvosi Vegytani, Molekuláris Biológiai és Patobiokémiai Intézet intermembrán tér Fe-S FMN NADH mátrix I. komplex: NADH-KoQ reduktáz


MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav,

MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, proteoglikánok) (3.)Multiadhéziós fehérjék és sejtfelszíni receptorok





Diabéteszes redox változások hatása a stresszfehérjékre

Diabéteszes redox változások hatása a stresszfehérjékre Semmelweis Egyetem Molekuláris Orvostudományok Tudományági Doktori Iskola Pathobiokémia Program Doktori (Ph.D.) értekezés Diabéteszes redox változások hatása a stresszfehérjékre dr. Nardai Gábor Témavezeto:


A Magyar Tudományos Akadémia Természettudományi Kutatóközpontja

A Magyar Tudományos Akadémia Természettudományi Kutatóközpontja A Magyar Tudományos Akadémia Természettudományi Kutatóközpontja Keserű György Miklós Az MTA TTK küldetése: multidiszciplináris kutatások komplex rendszereken Ember Anyagtudomány


Receptorok és szignalizációs mechanizmusok

Receptorok és szignalizációs mechanizmusok Molekuláris sejtbiológia: Receptorok és szignalizációs mechanizmusok Dr. habil Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immunbiológiai Intézet Sejtek szignalizációs kapcsolatai Sejtek szignalizációs


A KAR-2, egy antimitotikus ágens egyedi farmakológiájának atomi és molekuláris alapjai

A KAR-2, egy antimitotikus ágens egyedi farmakológiájának atomi és molekuláris alapjai A KAR-2, egy antimitotikus ágens egyedi farmakológiájának atomi és molekuláris alapjai A doktori értekezés tézisei Horváth István Eötvös Loránd Tudományegyetem Biológia Doktori Iskola (A Doktori Iskola


Sejtek - őssejtek dióhéjban. 2014. február. Sarkadi Balázs, MTA-TTK Molekuláris Farmakológiai Intézet - SE Kutatócsoport, Budapest

Sejtek - őssejtek dióhéjban. 2014. február. Sarkadi Balázs, MTA-TTK Molekuláris Farmakológiai Intézet - SE Kutatócsoport, Budapest Sejtek - őssejtek dióhéjban 2014. február Sarkadi Balázs, MTA-TTK Molekuláris Farmakológiai Intézet - SE Kutatócsoport, Budapest A legtöbb sejtünk osztódik, differenciálódik, elpusztul... vérsejtek Vannak


Norvég Finanszírozási Mechanizmus által támogatott projekt HU-0115/NA/2008-3/ÖP-9 ÚJ TERÁPIÁS CÉLPONTOK AZONOSÍTÁSA GENOMIKAI MÓDSZEREKKEL



Opponensi bírálói vélemény Dr. Hegyi Péter

Opponensi bírálói vélemény Dr. Hegyi Péter Opponensi bírálói vélemény Dr. Hegyi Péter A pankreász vezetéksejtek élettani és kórélettani jelentősége MTA doktori értekezésének bírálata Dr. Hegyi Péter értekezésében az elméleti és az alkalmazott orvostudomány


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


Az AT 1A -angiotenzinreceptor G-fehérjétől független jelátvitelének vizsgálata C9 sejtekben. Doktori tézisek. Dr. Szidonya László

Az AT 1A -angiotenzinreceptor G-fehérjétől független jelátvitelének vizsgálata C9 sejtekben. Doktori tézisek. Dr. Szidonya László Az AT 1A -angiotenzinreceptor G-fehérjétől független jelátvitelének vizsgálata C9 sejtekben Doktori tézisek Dr. Szidonya László Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola Témavezető:





A humán multidrog transzporter MDR1 klinikai és biokémiai vizsgálata

A humán multidrog transzporter MDR1 klinikai és biokémiai vizsgálata A humán multidrog transzporter MDR1 klinikai és biokémiai vizsgálata Doktori (Ph.D.) értekezés tézisei Dr. Szakács Gergely Semmelweis Egyetem Doktori Iskola Pathobiokémia Program Témavezető: Dr. Sarkadi


FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino


A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata

A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata Ph.D. ÉRTEKEZÉS TÉZISEI A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata Buzás-Bereczki Orsolya Témavezetők: Dr. Bálint Éva Dr. Boros Imre Miklós Biológia


Vérszérum anyagcseretermékek jellemzése kezelés alatt lévő tüdőrákos betegekben

Vérszérum anyagcseretermékek jellemzése kezelés alatt lévő tüdőrákos betegekben - Nyitott - Ingyenes Vérszérum anyagcseretermékek jellemzése kezelés alatt lévő tüdőrákos betegekben


Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén

Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Dr. Dallmann Klára A molekuláris biológia célja az élőlények és sejtek működésének molekuláris szintű


Új terápiás lehetőségek (receptorok) a kardiológiában

Új terápiás lehetőségek (receptorok) a kardiológiában Új terápiás lehetőségek (receptorok) a kardiológiában Édes István Kardiológiai Intézet, Debreceni Egyetem Kardiomiociták Ca 2+ anyagcseréje és új terápiás receptorok 2. 1. 3. 6. 6. 7. 4. 5. 8. 9. Ca


Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól

Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól Kele Péter egyetemi adjunktus Lumineszcencia jelenségek Biolumineszcencia (biológiai folyamat, pl. luciferin-luciferáz) Kemilumineszcencia
