Szakmai beszámoló. az F49514 számú, című ifjúsági OTKA pályázathoz

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Szakmai beszámoló. az F49514 számú, című ifjúsági OTKA pályázathoz"


1 Szakmai beszámoló az F49514 számú, Lokális mechanikai stabilitás és rugalmasság a titin izomfehérjében című ifjúsági OTKA pályázathoz Pályázatom célja volt megvizsgálni és leírni a titin óriás izomfehérje egyes szakaszainak mechanikai tulajdonságait. A titinmolekulák az izomrost hossztengelyével párhuzamosan helyezkednek el, és legfőbb szerepük az izom passzív rugalmasságának biztosítása. Rugószerű működésük szolgáltatja azt az erőt, amely az izom megnyújtását követően visszaállítja annak eredeti hosszát. Ennek megfelelően a titinmolekula mechanikai tulajdonságainak ismerete nélkülözhetetlen a molekula funkciójának megértése szempontjából. Differenciálisan expresszálódó immunglobulin domének vizsgálata A titinmolekula tömegének mintegy 90%-át globuláris szerkezetű domének lineáris sorozata teszi ki. A domének az immunglobulin (Ig) illetve a fibronektin III típusú domének szupercsaládjába sorolhatók (1. ábra). 1. ábra. A titin moduláris felépítése. Munkánk során a titin megnyújtható, I-szakaszából, és azon belül a csak vázizomban kifejeződő, ún. differenciálisan expresszálódó régióból kiválasztott szakaszt állítottunk elő és vizsgáltunk meg. A nyolc, sorba kapcsolt, immunglobulin típusú doménből álló molekulaszakaszt (I55-62) bakteriális fehérjeexpressziós rendszerben termeltettük meg, majd egy egyedi molekulák mechanikai manipulációjára alkalmas atomerőmikroszkóp segítségével megnyújtottuk, hogy jellemezzük annak mechanikai tulajdonságait. A mérésekhez használt üveg fedőlemezek felszínét vákuum-gőzölés segítségével vékony arany réteggel vontuk be, hogy elősegítsük a molekulaszakasz egyik, két szomszédos ciszteint tartalmazó végének nagy erősségű kötődését a felszínhez (2a. ábra). 1

2 2. ábra. Titin domén oktamer mechanikai manipulációja atomerőmikroszkóppal. a) Kísérleti elrendezés. b) Az I55-62 domén oktamerre jellemző erő-megnyúlás görbe és a görbe egyes pontjaihoz tartozó állapotok. A kiterekedési görbéken megfigyelt fűrészfog-szerű csúcsok megfelelnek az egyes domének kitekeredésének (2b. ábra). A vizsgált szakaszt alkotó domének mechanikai stabilitását azon erő segítségével jellemeztük, amelynél az egyes domének kitekerednek. A csúcsok felszálló ágait a féregszerű lánc (wormlike chain, WLC) polimermodellt leíró egyenlettel illesztettük, amely alapján kiszámoltuk a domének kiterekedéséhez tartozó kontúrhossz növekményt. A kapott érték (29,8 ± 3,5 nm) igazolja, hogy valóban az adott doméneket nyújtottuk meg. Az I55-62 szakasz esetén, 500 nm/s húzási sebesség mellett mért kitekeredési erők átlaga 237 pn volt, az erők azonban viszonylag széles tartományban változtak (3. ábra). Az oktameren belül tehát valószínűleg egymástól eltérő stabilitású domének találhatók. 3. ábra. Az I55-62 domén oktamer kitekeredési erőinek eloszlása. Korábban felvetették, hogy a titin differenciálisan expresszálódó doménjei mechanikailag kevésbé stabilak, így megnyújtás hatására előbb tekerednek ki, és ezáltal megóvják a konstitutívan expresszálódó doméneket a kitekeredéstől. Eredményeink azonban azt mutatják, hogy a titin differenciálisan expresszálódó szakaszát alkotó domének stabilitása széles tartományban változhat, és nem szisztematikusan alacsonyabb, mint a konstitutívan expresszálódó doméneké. A fenti eredmények alapján egy nemzetközi folyóiratban publikált közlemény [1] és két konferencia-absztrakt jelent meg, amelyek közül az egyiket a szervezők előadásra jelölték ki. 2

3 A PEVK szakasz vizsgálata A titin felépítésében részt vevő egyedi szekvenciák közül a legismertebb és funkcionális szempontból is legfontosabb a titin I-szakaszbeli részében található PEVK szegmens, amely nevét a több mint 70%-át kitevő prolin (P), glutaminsav (E), valin (V) és lizin (K) aminosavakról kapta. A szarkomer megfeszítése során a tandem Ig szegmensek megnyúlása mellett a PEVK megnyúlása járul hozzá legjelentősebb mértékben a passzív izomerő kialakításához [2]. Korábbi munkák alapján feltételezhető volt, hogy a PEVK régió ideális polimerláncként viselkedik, amely nem vagy alig rendelkezik másodlagos szerkezettel, rugalmassága pedig leírható a féregszerű lánc (wormlike chain, WLC) modellel [3,4]. PEVK peptideken végzett vizsgálatok azt is kimutatták, hogy azok rendelkeznek a rendezetlen fehérjék legtöbb jellemzőjével [5]. További eredmények ugyanakkor arra utaltak, hogy másodlagos szerkezeti elemek (II típusú poliprolin hélixek) jelen lehetnek a PEVK-n belül [6,7]. Hogy megvizsgáljuk, a PEVK szakasz valóban ideális polimerláncként viselkedik-e, a PEVK szakaszból kiválasztott két peptidet egy 11 aminosav hosszúságú (WEEAYQEREVC, PEVK11) és egy 21 aminosav hosszúságú (WEEAYQEREVIQVQKEVYEEC, and PEVK21) peptidet állítuttunk elő szilárdfázisú szintézis segítségével. A peptidek N-terminálisára egy triptofán aminosavat, C-terminálisára pedig egy IAEDANS fluorofórt kapcsoltunk, és fluoreszcencia spektroszkópia segítségével követtük a triptofán mint donor és az IAEDANS mint akceptor között lejátszódó fluoreszcencia rezonancia energiatranszfert (FRET). Meghatároztuk az energiatranszfer hatásfokát (E), amelynek felhasználásával kiszámítottuk a donor és akceptor fluorofórok közötti távolságot: R = R 6 0 E R 6 0 6, ahol R 0 a Förster-féle kritikus távolság, amely mellett a transzfer hatásfoka 50% (a triptofán- IAEDANS pár esetén 2,2 nm). Az ideális polimerek konformációját leíró féregszerű lánc (WLC) modell összefüggést teremt a polimer kontúrhossza (a kontúr mentén mért hossz, L), vég-vég távolsága (R) és perzisztenciahossza között (a hajlítási merevségét leíró mennyiség, amely felfogható, mint azon legrövidebb szakasz hossza, amely még merevnek tekinthető, P): R 2 = 2PL 1 P L L 1 e P A vizsgált peptidek kontúrhosszát az aminosavak száma alapján számoltuk (L = aminosavak száma aminosavak távolsága (0,38 nm) + az IAEDANS molekula mérete (0,87 nm). A vég-vég távolságot a FRET mérések alapján határoztuk meg, a látszólagos perzisztenciahosszakat pedig a fentebb megadott WLC egyenlet alapján. Natív körülmények között (20 C és 0,2 M ionerő) az így meghatározott vég-vég távolság értékei 1,86 és 2,12 nm voltak a PEVK11 illetve PEVK21 peptidek esetén (számolt kontúrhosszaik 4,18 és 7,98 nm). Az ezen értékek alapján számolt látszólagos perzisztenciahosszak 0,41 illetve 0,28 nm-nek adódtak. Az általunk kapott értékek a korábbi, a PEVK szakaszon végzett vizsgálatokban kapott értékek tartományának alsó régiójában találhatók (0,1-2,5 nm, [8,9,10]) és hasonlóak a teljesen kitekeredett polipeptidek esetén mért értékekhez (0,4-0,44 nm, [11,12,13]). A PEVK21 peptid esetén 3

4 kapott alacsonyabb érték arra utal, hogy adott hatások a látszólagos perzisztenciahossz csökkenését eredményezik. A két peptid esetén kapott, jelentősen különböző értékek azt jelzik, hogy alakjuk nem írható le a WLC modellel, tehát nem tekinthetők ideális polimerláncnak. A jelenség hátterében a perzisztenciahosszban a peptidek szekvenciája mentén megfigyelhető inhomogenitások, valamint a lánc egyes elemei között fennálló kölcsönhatások állhatnak, amelyeket az ideális polimermodell kizár. Hogy bepillantást nyerjünk a PEVK szerkezeti dinamikájába, megvizsgáltuk a környezeti paraméterek hatását a peptidek konfigurációjára. A szerkezeti dinamika jellemzése érdekében kiszámoltuk az f ' paramétert (a donor fluoreszcencia intenzitásával normált transzferhatásfok): f ' = E F DA Az f ' érték a donor és akceptor fluorofórok közötti fehérjemátrix flexibilitását jellemzi [14]. A hőmérséklet 5-50 C tartományban történő növelése mellett az f ' paraméter mindkét peptid esetén monoton növekedést mutatott. 4. ábra. Hőmérséklet hatása a PEVK peptidek konformációs dinamikájára. A növekedés valószínűleg a termikus fluktuációk amplitúdóinak növekedésével magyarázható, ami a transzferhatásfokot, annak R 6 -tól való függése miatt abban az esetben is megváltoztatja, ha az átlagos donor-akceptor távolság változatlan marad [14]. Az f ' növekedésének meredeksége a két peptid esetén azonos volt, ami arra utal, hogy a termikus fluktuációk is azonos mértékben növekedtek. A monoton változás azt jelzi, hogy konformációs átmenetek nem történtek, vagy csak nagyon kis mértékűek voltak. Hogy megvizsgáljuk, léteznek-e a peptideken belül olyan kölcsönhatások, amelyek kémiai denaturánsok segítségével befolyásolhatók, guanidin-hidroklorid növekvő koncentrációja mellett meghatároztuk a vég-vég távolságokat. A 0-6 M denaturáns koncentráció tartományban a vég-vég távolságok kis mértékben és fokozatosan megnőttek (1,86 nm-ről 2,02 nm-re a PEVK11 és 2,12 nmről 2,32 nm-re a PEVK21 peptid esetén). 4

5 5. ábra. Kémiai denaturáns hatása a PEVK peptidek vég-vég távolságára. A mérést urea alkalmazásával megismételve, a fentiekhez hasonló eredményt kaptunk. A megfigyelések lehetséges magyarázata az, hogy a peptideken belül létezhetnek olyan kölcsönhatások, amelyek a vég-vég távolság csökkenését okozzák, és amelyek kémiai denaturánsok segítségével fokozatosan megszüntethetők. Hasonló mérések segítségével az ionerősség hatását is megvizsgáltuk növekvő koncentrációjú KCl oldat alkalmazásával. Eredményeink alapján a növekvő ionerősség hatására a vég-vég távolság és a látszólagos perzisztenciahossz lecsökkent. A változások alacsonyabb ionerősség mellett kisebb, moláros nagyságrendű KCl koncentrációk esetén azonban nagyobb mértékűek voltak. 6. ábra. Ionerősség hatása a PEVK peptidek vég-vég távolságára. A jelenség hátterében olyan, a peptid szegmensek között fennálló elektrosztatikus kölcsönhatások állhatnak, amelyek a peptidlánc kimerevedését okozhatják. A közeg ionerősségének növelésével az ionok leárnyékolhatják ezeket a kölcsönhatásokat, ami a vég-vég távolság csökkenéséhez vezethet. Ezek a megfigyelések összhangban vannak korábbi mérésekkel, amelyekben csökkenő ionerősség hatására miofibrillumok titin-alapú merevségének csökkenését [15], illetve humán fetális titin PEVK szakasz perzisztenciahosszának csökkenését mutatták ki [16]. Összefoglalva, eredményeink azt mutatják, hogy a titin PEVK szakasza valószínűleg nem tekinthető szerkezet nélküli, ideális polimerláncnak. A különböző hosszúságú peptidek perzisztenciahosszában megfigyelt különbség átmeneti másodlagos szerkezeti elemek illetve láncszegmensek közötti kölcsönhatások jelenlétét veti fel. Ezen kölcsönhatások valószínűleg elektrosztatikus természetűek, és ahogy korábban azt már felvetették [15] egy entalpikus járulékot jelenthetnek a PEVK szakasznak a WLC modellen alapuló, kizárólag entropikus eredetű rugalmasságán felül. Míg megfigyeléseinket rövid peptideken tettük, a korábbi munkák szinte 5

6 kizárólag hosszabb PEVK szegmensek vagy miofibrillumokon történtek. Bár rövid peptideken az ionerő-függő változások kis mértékűek voltak, a teljes (vázizomban akár több mint 2000 aminosav hosszúságú) PEVK szakasz esetén ezen hatások elég jelentősek lehetnek ahhoz, hogy egy mechanizmust szolgáltassanak a lokális rugalmasság finomhangolására az izomban. A PEVK peptidekhez kapcsolódó eredményeket három konferencián poszter formájában mutattuk be, valamint folyamatban van egy kézirat elkészítése. A titin kináz domén vizsgálata A titinnel kapcsolatos kutatásokban az utóbbi évek fordulatot hoztak, mivel a titin rugalmasságát meghatározó I-szakaszbeli elemek vizsgálata helyett a titin egyedi szekvenciáinak vizsgálata került előtérbe. Ezek az elemek a rugalmasság meghatározásában, valamint a mechanikai erő érzékelésében tölthetnek be fontos szerepet [17,18,19]. Két speciális elem, amelyeknek jelentőséget tulajdonítottak ebből a szempontból, a titin C-terminálisához közel található kináz domén, valamint a titin N-terminálisán található, annak Z-lemezhez történő horgonyzásában fontos Z1 és Z2 domének. További vizsgálataink tárgyául a fenti titin szakaszokat választottuk (1. ábra). Célul tűztük ki a titin kináz doménjének expresszióját, mechanikai tulajdonságainak vizsgálatát, valamint az ATP kötődés és hidrolízis követését a kináz domén mechanikai manipulációja során. A 2006-os évben csoportunk sikerrel fejlesztett ki egy módszert, amely segítségével megvalósítható biomolekulák egyidejű mechanikai és fluoreszcens vizsgálata [20]. A módszer alapja egy atomerőmikroszkóp és egy evaneszcens mező mikroszkóp ötvözése, amelyen belül a két vizsgálati technika térbeli és időbeli szinkronizációja is megoldott. Célunk volt az evaneszcens mező mikroszkóp használata fluoreszcens ATP analóg kötődésének és disszociációjának detektálására, miközben a kináz domént az atomerőmikroszkóp segítségével ellenőrzött mechanikai feszültségnek tesszük ki. A titin kináz domént az előtte és utána található két-két immunglobulin doménnel együtt (hogy azok fogantyúkként megkönnyítsék a kináz két végének megragadását) a rendelkézésre álló humán soleus izom cdns könyvtárból klónoztuk és beillesztettük egy bakteriális expressziós vektorba (pet28a). Bár a baktériumokban kimutatható volt az expresszált fehérje, annak kinyerése és tisztítása több különböző stratégia alkalmazásával sem sikerült megfelelő mértékben. A továbbiakban elkezdtük a fehérje expressziójának előkészítését egy baculovírus expressziós rendszerben. Időközben, 2008 nyarán Mathias Gautel munkacsoportja publikálta az általuk a titin kinázon végzett méréseket, amelyek során kimutatták, hogy a molekula mechanikai megfeszítése még a kináz domén kitekeredése előtt aktiválja az ATP kötést, így a kináz mechanikai erőszenzorként működhet [21]. A titin kinázhoz kapcsolódó kísérleteket ezt követően felfüggesztettük. A Z1Z2-telethonin komplex vizsgálata A titin Z-lemezhez való horgonyzásáért a titin N-terminálisán található két Ig-domén (Z1 és Z2), valamint a Z-lemezben található telethonin fehérje által alkotott komplex a felelős, amelyben a telethonin a Z1Z2 doméneken keresztül keresztköt két titinmolekulát (7. ábra). A Z1Z2-telethonin komplexben a komponensek egy palindrom-szerű elrendeződésben 2:1 arányú antiparallel szendvicset képeznek [22]. Horgony-funkciója miatt a komplexnek feltehetően nagy mechanikai stabilitással kell rendelkeznie. Bár molekuláris dinamikai szimulációkban a komplex 6

7 disszociációjához szükséges erők igen jelentősnek adódtak (>1000 pn), az erők nagyságáról kísérletes adatok nem álltak rendelkezésre. A szimuláció során kapott szokatlanul nagy erők ezen felül az atomerőmikroszkóp esetén alkalmazottnál több nagyságrenddel nagyobb húzási sebességek esetére vonatkoztak. 7. ábra. A Z1Z2-telethonin komplex elhelyezkedése az izom szarkomerben. Célunk ezért a Z1Z2-telethonin komplex létrehozása, valamint mechanikai stabilitásának vizsgálata volt. Vizsgálni kívántuk továbbá, hogy milyen nagyságú erők mellett tekerednek ki önmagukban a Z1 és Z2 domének, amelyeket nem stabilizál a telethonin. A Z1Z2 szekvenciáját humán soleus cdns könyvtárból erősítettük ki, majd pet28a expressziós vektorba illesztettük be. A telethonin petm11 vektorban állt rendelkezésünkre. BL21 E. coli sejtekben mindkét fehérjét sikerrel expresszáltuk és tisztítottuk. A klónozás során mindkét fehérje N-terminálisára egy hexahisztidin tag-et, a Z1Z2 C-terminálisára pedig két vicinális cisztein aminosavat illesztettünk. Az így kapott végek a fehérjék tisztításában kaptak szerepet, valamint alkalmasak specifikus kötések létrehozására a mechanikai manipulációs vizsgálatok során. Mivel a telethonin önmagában nem rendelkezik stabil szerkezettel, és aggregátumokat képez, a komplexet a denaturált komponensek lassú renaturációjával hoztuk létre. A komplex kialakulását kromatográfiával kombinált proteázhasítással illetve atomerőmikroszkópos topográfiai képalkotás segítségével igazoltuk. A Z1Z2 szakasz mechanikai stabilitásának vizsgálata során, mivel a két domén hosszúságú szakasz viszonylag rövid, és aránylag kevés sikeres, specifikusan az N- és C-terminális végeknél fogva történő megnyújtást tesz lehetővé, a C-terminális cisztein aminosavak felhasználásával négy domén hosszúságú Z1Z2 dimert képeztünk, redukáló környezetet használva a ciszteinek közötti diszulfid hidak létrehozására. A konstrukció atomerőmikroszkóppal történő mechanikai denaturációja során rögzített görbéken megfigyelhetők voltak a domének kitekeredésére jellemző fűrészfog-szerű csúcsok (8a. ábra), amelyek alapján meghatároztuk a kitekeredési eseményekhez tartozó erőt és kontúrhossz-növekményt. Utóbbi (29,3 ± 2,4 nm) közelítőleg azonos volt a domének aminosav sorrendjéből adódó, elméletileg várt értékekkel (32-34 nm), amit felhasználhattunk annak igazolására, hogy valóban a Z1Z2 doméneket nyújtottuk meg. Az 500 nm/s húzási sebesség mellett megfigyelt kitekeredési erő 122 ± 7 pn értékű volt. 7

8 a b c d 8. ábra. a) A Z1Z2 dimerek esetén atomerőmikroszkóppal mért erő-megnyúlás görbék. b) A Z1Z2 domének kitekeredési erőinek húzási sebességtől való függése. c) A kitekeredést kétállapotú modellben leíró energiaprofil. d) Példa Monte- Carlo szimuláció során kapott erő-megnyúlás görbékre. A kitekeredés energiaprofil jellemzése érdekében dinamikus erőspektroszkópiát végeztünk, azaz erő-megnyúlás görbéket gyűjtöttünk különböző húzási sebességek esetén, a nm/s tartományban. A görbék alapján meghatározott kitekeredési erők a húzási sebesség logaritmusa függvényében ábrázolva egy egyenessel voltak illeszthetők (8b. ábra). A függés arra utal, hogy a Z1Z2 domének kitekeredése leírható egy kétállapotú rendszerrel, amelynek energiaprofilját a 8c. ábra szemlélteti. Ebben az esetben a kitekeredési erő terhelési sebességtől (r) való függését az F = kt Δx ln rδx kt k 0 képlet írja le, ahol k a Boltzmann állandó, T az abszolút hőmérséklet, Δx a natív állapot távolsága a tranzíciós állapottól, vagyis az a távolság, amellyel megnövelve az adott domén vég-vég távolságát, az átbillen az átmeneti állapoton és kitekeredik. k 0 a nulla erő mellett mért kitekeredési sebesség, amely közvetlen összefüggésben van a natív és tranzíciós állapot közötti szabadenergia különbséggel (ΔG TN). A terhelési sebességet (időegységre eső erőnövekedés) a kitekeredési görbéknek a csúcspontban mért meredekségeként határoztuk meg. A fenti képlet alapján ezután illesztéssel meghatároztuk a kitekeredési energiaprofil paramétereit. Δx ily módon meghatározott értéke 0,52 nm, k 0 értéke pedig 0,0008 1/s volt. 8

9 Az így kapott paraméterekkel kétállapotú rendszert feltételezve, Monte-Carlo szimulációkat végeztünk (8d. ábra) [23]. A szimulációk során a különböző húzási sebességek esetén kapott kitekeredési erők a hibahatáron belül jól visszaadták a mérés során (8b. ábra) kapott ereményeket. A Z1Z2 domének esetén mért kitekeredési erők alacsonyabbak, mint más, korábban vizsgált immunglobulin típusú domének esetén mért értékek, ami arra utal, hogy a Z1Z2-telethonin komplex stabilizálásában a Z1Z2 domének önmagukban nem jelentősek. A komplex stabilitásában valószínűleg a Z1Z2 telethoninnal alkotott kötései játszanak lényeges szerepet, amelyeken keresztül a fehérjék egymás stabilitását növelik. A Z1Z2 domének vizsgálata során kapott eredményeinket egy kéziratban terveztük összefoglalni. Még dolgoztunk a kéziraton, amikor megjelent Matthias Rief munkacsoportjának egy publikációja [24] amelyben leírták a Z1Z2-telethonin komplex mechanikai stabilitásával kapcsolatos eredményeiket. Ennek keretében a Z1Z2 domének stabilitását telethonin hiányában is megvizsgálták, azok kitekeredési erőire 1 µm/s húzási sebesség mellett a 168 ± 2 pn értéket kapták. Ez az érték kis mértékben eltér, de összemérhető az általunk kapott, 142 ± 8 pn-os értékkel. A Z1Z2 domének vizsgálatához kapcsolódó eredményeket két konferencián poszter formájában mutattuk be. Jelenleg, a Rief munkacsoport cikkének megjelenése miatt célunk mérési eredményeinket kibővíteni, hogy azokat közlemény formájában publikálhassuk. Irodalomjegyzék 1. Grama L, Nagy A, Scholl C, Huber T, Kellermayer M (2005) Local Variability in the Mechanics of Titin's Tandem Ig Segments. Croatica Chemica Acta 78(3): Linke WA, Rudy DE, Centner T, Gautel M, Witt C, et al. (1999) I-band titin in cardiac muscle is a three-element molecular spring and is critical for maintaining thin filament structure. The Journal of Cell Biology. pp Labeit S, Kolmerer B, Linke WA (1997) The giant protein titin. Emerging roles in physiology and pathophysiology. Circulation Research. pp Linke WA, Ivemeyer M, Mundel P, Stockmeier MR, Kolmerer B (1998) Nature of PEVK-titin elasticity in skeletal muscle. Proc Natl Acad Sci USA. pp Duan Y, DeKeyser JG, Damodaran S, Greaser ML (2006) Studies on titin PEVK peptides and their interaction. Archives of Biochemistry and Biophysics. pp Ma K, Kan L, Wang K (2001) Polyproline II helix is a key structural motif of the elastic PEVK segment of titin. Biochemistry. pp Ma K, Wang K (2003) Malleable conformation of the elastic PEVK segment of titin: non-cooperative interconversion of polyproline II helix, beta-turn and unordered structures. Biochem J. pp Li H, Oberhauser AF, Redick SD, Carrion-Vazquez M, Erickson HP, et al. (2001) Multiple conformations of PEVK proteins detected by single-molecule techniques. Proc Natl Acad Sci USA. pp Nagy A (2005) Hierarchical Extensibility in the PEVK Domain of Skeletal-Muscle Titin. Biophysical Journal. pp Watanabe K (2002) Molecular Mechanics of Cardiac Titin's PEVK and N2B Spring Elements. Journal of Biological Chemistry. pp

10 11. Buscaglia M, Lapidus LJ, Eaton WA, Hofrichter J (2006) Effects of denaturants on the dynamics of loop formation in polypeptides. Biophys J 91: Oberhauser AF, Marszalek PE, Erickson HP, Fernandez JM (1998) The molecular elasticity of the extracellular matrix protein tenascin. Nature 393: Rief M, Gautel M, Oesterhelt F, Fernandez JM, Gaub HE (1997) Reversible unfolding of individual titin immunoglobulin domains by AFM. Science 276: Somogyi B, Matko J, Papp S, Hevessy J, Welch GR, et al. (1984) Forster-type energy transfer as a probe for changes in local fluctuations of the protein matrix. Biochemistry 23: Linke WA, Ivemeyer M, Mundel P, Stockmeier MR, Kolmerer B (1998) Nature of PEVK-titin elasticity in skeletal muscle. Proc Natl Acad Sci U S A 95: Forbes JG, Jin AJ, Ma K, Gutierrez-Cruz G, Tsai WL, et al. (2005) Titin PEVK segment: chargedriven elasticity of the open and flexible polyampholyte. J Muscle Res Cell Motil 26: LeWinter MM, Wu Y, Labeit S, Granzier H (2007) Cardiac titin: structure, functions and role in disease. Clin Chim Acta. pp Linke WA (2008) Sense and stretchability: the role of titin and titin-associated proteins in myocardial stress-sensing and mechanical dysfunction. Cardiovascular Research. pp Miller M (2004) The sensitive giant: the role of titin-based stretch sensing complexes in the heart. Trends in Cell Biology. pp Kellermayer MSZ, Karsai A, Kengyel A, Nagy A, Bianco P, et al. (2006) Spatially and temporally synchronized atomic force and total internal reflection fluorescence microscopy for imaging and manipulating cells and biomolecules. Biophysical Journal. pp Puchner EM, Alexandrovich A, Kho AL, Hensen U, Schäfer LV, et al. (2008) Mechanoenzymatics of titin kinase. Proc Natl Acad Sci USA. pp Zou P, Pinotsis N, Lange S, Song Y-H, Popov A, et al. (2006) Palindromic assembly of the giant muscle protein titin in the sarcomeric Z-disk. Nature. pp Rief M, Fernandez J, Gaub H (1998) Elastically coupled two-level systems as a model for biopolymer extensibility. Phys Rev Lett. pp Bertz M, Wilmanns M, Rief M (2009) The titin-telethonin complex is a directed, superstable molecular bond in the muscle Z-disk. Proc Natl Acad Sci U S A 106:

Nanomedicina Szimpózium, 2008. Nanomechanika: Egyedi Biomolekulák Manipulálása. Kellermayer Miklós

Nanomedicina Szimpózium, 2008. Nanomechanika: Egyedi Biomolekulák Manipulálása. Kellermayer Miklós Nanomedicina Szimpózium, 28 Nanomechanika: Egyedi Biomolekulák Manipulálása Kellermayer Miklós Semmelweis Egyetem Általános Orvostudományi Kar Biofizikai és Sugárbiológiai Intézet ÉLŐ SEJTBEN: BONYOLULT


Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai

Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Fogorvosi Anyagtan Fizikai Alapjai Biomolekulák nanomechanikája A biomolekuláris rugalmasság alapjai Mártonfalvi Zsolt Biofizikai és Sugárbiológiai Intézet Semmelweis Egyetem Budapest Biomolekulák mint


A titin PEVK domén aktinkötő és mechanikai tulajdonságai

A titin PEVK domén aktinkötő és mechanikai tulajdonságai PhD értekezés A titin PEVK domén aktinkötő és mechanikai tulajdonságai Nagy Attila Pécsi Tudományegyetem Általános Orvostudományi Kar Biofizikai Intézet Pécs 2006 A program megnevezése: Programvezető:


DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,


K68464 OTKA pályázat szakmai zárójelentés

K68464 OTKA pályázat szakmai zárójelentés K68464 OTKA pályázat szakmai zárójelentés A fehérjeaggregáció és amiloidképződés szerkezeti alapjai; a különféle morfológiájú aggregátumok kialakulásának körülményei és in vivo hatásuk vizsgálata Vezető


Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól

Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól Kele Péter egyetemi adjunktus Lumineszcencia jelenségek Biolumineszcencia (biológiai folyamat, pl. luciferin-luciferáz) Kemilumineszcencia


Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók

Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók Jelentősége szubsztrát kötődés szolvatáció ionizációs állapotok (pka) mechanizmus katalízis ioncsatornák szimulációk (szerkezet) all-atom dipolar fluid dipolar lattice continuum Definíciók töltéseloszlás


Az élő sejt fizikai Biológiája:

Az élő sejt fizikai Biológiája: Az élő sejt fizikai Biológiája: Modellépítés, biológiai rendszerek skálázódása Kellermayer Miklós Fizikai biológia Ma már nem csak kvalitatív megfigyeléseket, hanem kvantitatív méréseket végzünk (biológiai


FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino


Biofizika I 2013-2014 2014.12.02.



A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás.

Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Antigén felismerés Az ellenanyagok és a B sejt receptorok natív formában


Részletes szakmai beszámoló Az erbb proteinek asszociációjának kvantitatív jellemzése című OTKA pályázatról (F049025)

Részletes szakmai beszámoló Az erbb proteinek asszociációjának kvantitatív jellemzése című OTKA pályázatról (F049025) Részletes szakmai beszámoló Az erbb proteinek asszociációjának kvantitatív jellemzése című OTKA pályázatról (F049025) A pályázat megvalósítása során célunk volt egyrészt a molekulák asszociációjának tanulmányozására


Polimerek fizikai, mechanikai, termikus tulajdonságai

Polimerek fizikai, mechanikai, termikus tulajdonságai SZÉCHENYI ISTVÁN EGYETEM ANYAGISMERETI ÉS JÁRMŰGYÁRTÁSI TANSZÉK POLIMERTECHNIKA NGB_AJ050_1 Polimerek fizikai, mechanikai, termikus tulajdonságai DR Hargitai Hajnalka 2011.10.05. BURGERS FÉLE NÉGYPARAMÉTERES


Al-Mg-Si háromalkotós egyensúlyi fázisdiagram közelítő számítása

Al-Mg-Si háromalkotós egyensúlyi fázisdiagram közelítő számítása l--si háromalkotós egyensúlyi fázisdiagram közelítő számítása evezetés Farkas János 1, Dr. Roósz ndrás 1 doktorandusz, tanszékvezető egyetemi tanár Miskolci Egyetem nyag- és Kohómérnöki Kar Fémtani Tanszék


Biológiai makromolekulák szerkezete

Biológiai makromolekulák szerkezete Biológiai makromolekulák szerkezete Biomolekuláris nemkovalens kölcsönhatások Elektrosztatikus kölcsönhatások (sóhidak: 4-6 kcal/m, dipól-dipól: ~10-1 kcal/m Diszperziós erők (~10-2 kcal/m) Hidrogén hidak


Fehérjék nanomechanikai tulajdonságainak vizsgálata Atomi Er Mikroszkópiával NEMES CSILLA

Fehérjék nanomechanikai tulajdonságainak vizsgálata Atomi Er Mikroszkópiával NEMES CSILLA DOKTORI ÉRTEKEZÉS TÉZISEI Fehérjék nanomechanikai tulajdonságainak vizsgálata Atomi Er Mikroszkópiával NEMES CSILLA Témavezet : Dr. Rozlosnik Noémi ELTE, Biológiai Fizika Tanszék Semmelweis Orvostudományi


Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék

Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék Bio-nanorendszerek Vonderviszt Ferenc Pannon Egyetem Nanotechnológia Tanszék Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének befolyásolására. A technológiai



EGYMOLEKULA BIOFIZIKA Simons, Kai Ikonen, Elina (1997): Functional Rafts in Cell Membranes. Nature. 387, 6633, 569 572. DOI:10.1038/42408 Singer, Seymour J. Nicolson, Garth L. (1972): The Fluid Mosaic Model of The Structure


Mikroszkóp vizsgálata és folyadék törésmutatójának mérése (8-as számú mérés) mérési jegyzõkönyv

Mikroszkóp vizsgálata és folyadék törésmutatójának mérése (8-as számú mérés) mérési jegyzõkönyv (-as számú mérés) mérési jegyzõkönyv Készítette:, II. éves fizikus... Beadás ideje:... / A mérés leírása: A mérés során egy mikroszkóp különbözõ nagyítású objektívjeinek nagyítását, ezek fókusztávolságát


Fehérjék nyomás által indukált szerkezetváltozásainak jellemzése infravörös és fluoreszcencia spektroszkópiai módszerekkel

Fehérjék nyomás által indukált szerkezetváltozásainak jellemzése infravörös és fluoreszcencia spektroszkópiai módszerekkel Fehérjék nyomás által indukált szerkezetváltozásainak jellemzése infravörös és fluoreszcencia spektroszkópiai módszerekkel Doktori tézisek Somkuti Judit Semmelweis Egyetem Elméleti Orvostudományok Doktori


Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12.

Citoszkeleton. Sejtek rugalmassága. Polimer mechanika: Hooke-rugalmasság. A citoszkeleton filamentumai. Fogászati anyagtan fizikai alapjai 12. Fogászati anyagtan fizikai alapjai 12. Sejtek rugalmassága Citoszkeleton Eukariota sejtek dinamikus vázrendszere Három fő filamentum-osztály: A. Vékony (aktin) B. Intermedier C. Mikrotubulus Polimerizáció:


A módszerek jelentősége. Gyors-kinetika módszerek. A módszerek közös tulajdonsága. Milyen módszerekről tanulunk?

A módszerek jelentősége. Gyors-kinetika módszerek. A módszerek közös tulajdonsága. Milyen módszerekről tanulunk? Gyors-kinetika módszerek módszerek jelentősége 2010. március 9. Nyitrai Miklós biológiai mechanizmusok megértése; iológiai folyamatok időskálája; Vándorló melanocita (Victor SMLL). ms skálán való mérések.





Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek

Makromolekulák. Fehérjetekeredé. rjetekeredés. Biopolimer. Polimerek Biopolimerek Makromolekulá Makromolekulák. Fehé Fehérjetekeredé rjetekeredés. Osztódó sejt magorsófonala 2011. November 16. Huber Tamá Tamás Dohány levél epidermális sejtjének aktin hálózata Bakteriofágból


NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 NÖVÉNYÉLETTAN Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 Sejtfal szintézis és megnyúlás Környezeti tényezők hatása a növények növekedésére és fejlődésére Előadás áttekintése


Mikroszkóp vizsgálata Folyadék törésmutatójának mérése

Mikroszkóp vizsgálata Folyadék törésmutatójának mérése KLASSZIKUS FIZIKA LABORATÓRIUM 8. MÉRÉS Mikroszkóp vizsgálata Folyadék törésmutatójának mérése Mérést végezte: Enyingi Vera Atala ENVSAAT.ELTE Mérés időpontja: 2011. október 12. Szerda délelőtti csoport


3. Mesterséges izom:

3. Mesterséges izom: 3. Mesterséges izom: Erősíts polimer horgászzsinórt egy elektromos fúróra, majd kezdd el feltekerni a megfeszített zsinórt. Egy idő után a zsinóron rugó-szerű elrendezésben feszes spirálok képződnek. Hő


Egy antifungális diszulfid fehérje szerkezeti dinamikája és hideg/meleg kitekeredése (avagy PAF, a hűvös sárkány)

Egy antifungális diszulfid fehérje szerkezeti dinamikája és hideg/meleg kitekeredése (avagy PAF, a hűvös sárkány) Egy antifungális diszulfid fehérje szerkezeti dinamikája és hideg/meleg kitekeredése (avagy PAF, a hűvös sárkány) Batta Gyula Debreceni Egyetem Szerkezeti Biológiai és Molekuláris Felismerési Műhely



A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA A CITOSZKELETÁLIS RENDSZER FUTÓ KINGA 2013.10.09. CITOSZKELETON - DEFINÍCIÓ Fehérjékből felépülő, a sejt vázát alkotó intracelluláris rendszer. Eukarióta és prokarióta sejtekben egyaránt megtalálható.


A titin óriásfehérje nanomechanikája

A titin óriásfehérje nanomechanikája A titin óriásfehérje nanomechanikája Doktori értekezés Mártonfalvi Zsolt Semmelweis Egyetem Elméleti Orvostudományok Doktori Iskola Témavezető: Dr. Kellermayer Miklós egyetemi tanár, D.Sc. Hivatalos bírálók:



FLAGELLINALAPÚ MOLEKULÁRIS OBJEKTUMOK LÉTREHOZÁSA. Sebestyén Anett Pannon Egyetem Műszaki Informatikai Kar Nanotechnológia Tanszék FLAGELLINALAPÚ MOLEKULÁRIS OBJEKTUMOK LÉTREHOZÁSA Doktori (PhD) értekezés tézisei Sebestyén Anett Környezettudományok Doktori Iskola Témavezető:


Az élő sejt fizikai Biológiája: motorfehérjék, egyensúlytól távoli folyamatok

Az élő sejt fizikai Biológiája: motorfehérjék, egyensúlytól távoli folyamatok Tematika Az élő sejt fizikai Biológiája: motorfehérjék, egyensúlytól távoli folyamatok Kellermayer Miklós Motorfehérjék működése. A munkaciklus Egyensúlytól távoli folyamatok. Erővezérelt fehérjegombolyodás.


Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete

Biopolimer 12/7/09. Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. DNS. Polimerek. Kardos Roland DNS elsődleges szerkezete Biopolimerek Makromolekulák szerkezete. Fehérje szerkezet, és tekeredés. Osztódó sejt magorsófonala Kardos Roland 2009.10.29. Dohány levél epidermális sejtjének aktin hálózat Bakteriofágból kiszabaduló


Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői.

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői. Immunológia alapjai 3 4. előadás Az immunológiai felismerés molekuláris összetevői. Az antigén fogalma. Antitestek, T- és B- sejt receptorok: molekuláris szerkezet, funkciók, alcsoportok Az antigén meghatározása



TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL Az egyes biomolekulák izolálása kulcsfontosságú a biológiai szerepük tisztázásához. Az affinitás kromatográfia egyszerűsége, reprodukálhatósága


ERD14: egy funkcionálisan rendezetlen dehidrin fehérje szerkezeti és funkcionális jellemzése

ERD14: egy funkcionálisan rendezetlen dehidrin fehérje szerkezeti és funkcionális jellemzése Doktori értekezés tézisei ERD14: egy funkcionálisan rendezetlen dehidrin fehérje szerkezeti és funkcionális jellemzése DR. SZALAINÉ ÁGOSTON Bianka Ildikó Témavezetők Dr. PERCZEL András egyetemi tanár és


A KAR-2, egy antimitotikus ágens egyedi farmakológiájának atomi és molekuláris alapjai

A KAR-2, egy antimitotikus ágens egyedi farmakológiájának atomi és molekuláris alapjai A KAR-2, egy antimitotikus ágens egyedi farmakológiájának atomi és molekuláris alapjai A doktori értekezés tézisei Horváth István Eötvös Loránd Tudományegyetem Biológia Doktori Iskola (A Doktori Iskola


Flagellin alapú filamentáris nanoszerkezetek létrehozása

Flagellin alapú filamentáris nanoszerkezetek létrehozása Flagellin alapú filamentáris nanoszerkezetek létrehozása Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium MTA Enzimológiai Intézete MTA MFA Bakteriális flagellumok Flagelláris filamentum: ~10


A II. kategória Fizika OKTV mérési feladatainak megoldása

A II. kategória Fizika OKTV mérési feladatainak megoldása Nyomaték (x 0 Nm) O k t a t á si Hivatal A II. kategória Fizika OKTV mérési feladatainak megoldása./ A mágnes-gyűrűket a feladatban meghatározott sorrendbe és helyre rögzítve az alábbi táblázatban feltüntetett


Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás.

Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Az immunrendszer felépítése Veleszületett immunitás (komplement, antibakteriális


A hőterjedés dinamikája vékony szilikon rétegekben. Gambár Katalin, Márkus Ferenc. Tudomány Napja 2012 Gábor Dénes Főiskola

A hőterjedés dinamikája vékony szilikon rétegekben. Gambár Katalin, Márkus Ferenc. Tudomány Napja 2012 Gábor Dénes Főiskola A hőterjedés dinamikája vékony szilikon rétegekben Gambár Katalin, Márkus Ferenc Tudomány Napja 2012 Gábor Dénes Főiskola Miről szeretnék beszélni: A kutatás motivációi A fizikai egyenletek (elméleti modellek)


Kutatási beszámoló ( )

Kutatási beszámoló ( ) Kutatási beszámoló (2008-2012) A thrombocyták aktivációja alapvető jelentőségű a thrombotikus betegségek kialakulása szempontjából. A pályázat során ezen aktivációs folyamatok mechanizmusait vizsgáltuk.


Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983


-Két fő korlát: - asztrogliák rendkívüli morfológiája -Ca szignálok értelmezési nehézségei

-Két fő korlát: - asztrogliák rendkívüli morfológiája -Ca szignálok értelmezési nehézségei Nature reviewes 2015 - ellentmondás: az asztrociták relatív lassú és térben elkent Ca 2+ hullámokkal kommunikálnak a gyors és pontos neuronális körökkel - minőségi ugrás kell a kísérleti és analitikai


A harántcsíkolt izom struktúrája általános felépítés

A harántcsíkolt izom struktúrája általános felépítés harántcsíkolt izom struktúrája általános felépítés LC-2 Izom LC1/3 Izom fasciculus LMM S-2 S-1 HMM rod Miozin molekula S-1 LMM HMM S-2 S-1 Izomrost H Band Z Disc csík I csík M Z-Szarkomér-Z Miofibrillum


Vezetők elektrosztatikus térben

Vezetők elektrosztatikus térben Vezetők elektrosztatikus térben Vezető: a töltések szabadon elmozdulhatnak Ha a vezető belsejében a térerősség nem lenne nulla akkor áram folyna. Ha a felületen a térerősségnek lenne tangenciális (párhuzamos)


Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése

Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése Ferenczy György Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biokémiai folyamatok - Ligandum-fehérje kötődés


RÉSZLETES BESZÁMOLÓ Az OTKA által támogatott konzorcium működésében az Uzsoki utcai Kórház feladata a szövetminták gyűjtése, előzetes feldolgozása, ill. a betegek utánkövetése, valamint az utánkövétésre


A sztereoizoméria hatása peptidek térszerkezetére és bioaktivitására OTKA PD Szakmai zárójelentés. Dr. Leitgeb Balázs

A sztereoizoméria hatása peptidek térszerkezetére és bioaktivitására OTKA PD Szakmai zárójelentés. Dr. Leitgeb Balázs A sztereoizoméria hatása peptidek térszerkezetére és bioaktivitására OTKA PD 78554 Szakmai zárójelentés Dr. Leitgeb Balázs A projekt során azt tanulmányoztam, hogy a sztereoizoméria milyen hatásokat fejt


Rövid ismertető. Modern mikroszkópiai módszerek. A mikroszkóp. A mikroszkóp. Az optikai mikroszkópia áttekintése

Rövid ismertető. Modern mikroszkópiai módszerek. A mikroszkóp. A mikroszkóp. Az optikai mikroszkópia áttekintése Rövid ismertető Modern mikroszkópiai módszerek Nyitrai Miklós 2010. március 16. A mikroszkópok csoportosítása Alapok, ismeretek A működési elvek Speciális módszerek A mikroszkópia története ld. Pdf. Minél


Modern mikroszkópiai módszerek 2 2011 2012

Modern mikroszkópiai módszerek 2 2011 2012 FLUORESZCENCIA MIKROSZKÓPIA A mintának a megvilágító fény által kiváltott fluoreszcencia emisszióját képezzük le. 1 Bugyi Beáta - PTE ÁOK Biofizikai Intézet 2 FLUOROFÓROK BELSŐ (INTRINSIC) FLUORESZCENCIA


A biológiai mozgás molekuláris mechanizmusai

A biológiai mozgás molekuláris mechanizmusai BIOLÓGIAI MOZGÁSOK A biológiai mozgás molekuláris mechanizmusai Kollektív mozgás Szervezet mozgása ( Az évszázad ugrása ) Szerv mozgás BIOLÓGIAI MOZGÁSOK BIOLÓGIAI MOZGÁSOK Ritmusosan összehúzódó szívizomsejt


Biomolekuláris nanotechnológia. Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium

Biomolekuláris nanotechnológia. Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium Biomolekuláris nanotechnológia Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium Az élő szervezetek példája azt mutatja, hogy a fehérjék és nukleinsavak kiválóan alkalmasak önszerveződő molekuláris


Biofizika I 2013-2014 2014.12.03.

Biofizika I 2013-2014 2014.12.03. Biofizika I. -2014. 12. 02. 03. Dr. Bugyi Beáta PTE ÁOK Biofizikai Intézet A KERESZTHÍD CIKLUSHOZ KAPCSOLÓDÓ ERŐKIEJTÉS egy kereszthíd ciklus során a miozin II fej elmozdulása: í ~10 nm 10 10 egy kereszthíd


Polimer nanokompozit blendek mechanikai és termikus tulajdonságai

Polimer nanokompozit blendek mechanikai és termikus tulajdonságai SZÉCHENYI ISTVÁN EGYETEM Anyagtudományi és Technológiai Tanszék Polimer nanokompozit blendek mechanikai és termikus tulajdonságai Dr. Hargitai Hajnalka, Ibriksz Tamás Mojzes Imre Nano Törzsasztal 2013.


Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis Szerkezet Protein Data Bank (PDB) ~ 35 701 szerkezet közepes felbontás 1552 szerkezet d 1.5 Å 160 szerkezet d 1.0 Å 10 szerkezet d 0.8 Å (atomi felbontás) E globális minimum? funkció


A biológiai mozgások. A biológiai mozgás molekuláris mechanizmusai. Motorfehérjék. Motorfehérjék közös tulajdonságai

A biológiai mozgások. A biológiai mozgás molekuláris mechanizmusai. Motorfehérjék. Motorfehérjék közös tulajdonságai A biológiai mozgások Molekuláris mozgás A biológiai mozgás molekuláris mechanizmusai Celluláris mozgás Mártonfalvi Zsolt Bakteriális flagellum Szervezet mozgása Keratocita mozgása felületen 1 Motorfehérjék


Modern Fizika Labor. Értékelés: A mérés dátuma: A mérés száma és címe: Az optikai pumpálás. A beadás dátuma: A mérést végezte:

Modern Fizika Labor. Értékelés: A mérés dátuma: A mérés száma és címe: Az optikai pumpálás. A beadás dátuma: A mérést végezte: Modern Fizika Labor A mérés dátuma: 2005.10.19. A mérés száma és címe: 7. Az optikai pumpálás Értékelés: A beadás dátuma: 2005.10.28. A mérést végezte: Orosz Katalin Tóth Bence Optikai pumpálás segítségével


Modern Fizika Labor. A mérés száma és címe: A mérés dátuma: Értékelés: Infravörös spektroszkópia. A beadás dátuma: A mérést végezte:

Modern Fizika Labor. A mérés száma és címe: A mérés dátuma: Értékelés: Infravörös spektroszkópia. A beadás dátuma: A mérést végezte: Modern Fizika Labor A mérés dátuma: 2005.10.26. A mérés száma és címe: 12. Infravörös spektroszkópia Értékelés: A beadás dátuma: 2005.11.09. A mérést végezte: Orosz Katalin Tóth Bence 1 A mérés során egy


Mérési adatok illesztése, korreláció, regresszió

Mérési adatok illesztése, korreláció, regresszió Mérési adatok illesztése, korreláció, regresszió Korreláció, regresszió Két változó mennyiség közötti kapcsolatot vizsgálunk. Kérdés: van-e kapcsolat két, ugyanabban az egyénben, állatban, kísérleti mintában,


12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher


Mérési hibák 2006.10.04. 1

Mérési hibák 2006.10.04. 1 Mérési hibák 2006.10.04. 1 Mérés jel- és rendszerelméleti modellje Mérési hibák_labor/2 Mérési hibák mérési hiba: a meghatározandó értékre a mérés során kapott eredmény és ideális értéke közötti különbség


Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus


Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 5. mérés: Elektronspin rezonancia. 2008. március 18.

Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 5. mérés: Elektronspin rezonancia. 2008. március 18. Modern Fizika Labor Fizika BSc A mérés dátuma: 28. március 18. A mérés száma és címe: 5. mérés: Elektronspin rezonancia Értékelés: A beadás dátuma: 28. március 26. A mérést végezte: 1/7 A mérés leírása:


A mikroszkóp vizsgálata Lencse görbületi sugarának mérése Newton-gyűrűkkel Folyadék törésmutatójának mérése Abbe-féle refraktométerrel

A mikroszkóp vizsgálata Lencse görbületi sugarának mérése Newton-gyűrűkkel Folyadék törésmutatójának mérése Abbe-féle refraktométerrel A mikroszkóp vizsgálata Lencse görbületi sugarának mérése Newton-gyűrűkkel Folyadék törésmutatójának mérése Abbe-féle refraktométerrel Mérő neve: Márkus Bence Gábor Mérőpár neve: Székely Anna Krisztina


Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai

Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai Az áramlási citométer és sejtszorter felépítése és működése Kereskedelmi forgalomban kapható készülékek 1 Fogalmak


Biokatalitikus Baeyer-Villiger oxidációk Doktori (PhD) értekezés tézisei. Muskotál Adél. Dr. Vonderviszt Ferenc

Biokatalitikus Baeyer-Villiger oxidációk Doktori (PhD) értekezés tézisei. Muskotál Adél. Dr. Vonderviszt Ferenc Biokatalitikus Baeyer-Villiger oxidációk Doktori (PhD) értekezés tézisei Készítette: Muskotál Adél Környezettudományok Doktori Iskola Témavezető: Dr. Vonderviszt Ferenc egyetemi tanár Pannon Egyetem Műszaki





1.7. Felületek és katalizátorok

1.7. Felületek és katalizátorok Mobilitás és Környezet Konferencia Magyar Tudományos Akadémia Budapest, 2012. január 23. 1.7. Felületek és katalizátorok Polimer töltőanyagként alkalmazható agyagásvány nanostruktúrák előállítása Horváth


Kémiai reakciók mechanizmusa számítógépes szimulációval

Kémiai reakciók mechanizmusa számítógépes szimulációval Kémiai reakciók mechanizmusa számítógépes szimulációval Stirling András Elméleti Kémiai Osztály Budapest Stirling A. (MTA Kémiai Kutatóközpont) Reakciómechanizmus szimulációból 2007.


Biomolekuláris szerkezeti dinamika

Biomolekuláris szerkezeti dinamika Kísérletek, mérések célja Biomolekuláris szerkezeti dinamika Kellermayer Miklós Biomolekuláris szerkezet és működés pontosabb megismerése (folyamatok, állapotok, átmenetek, kölcsönhatások, stb.) Rádióspektroszkópiák


Járműelemek. Rugók. 1 / 27 Fólia

Járműelemek. Rugók. 1 / 27 Fólia Rugók 1 / 27 Fólia 1. Rugók funkciója A rugók a gépeknek és szerkezeteknek olyan különleges elemei, amelyek nagy (ill. korlátozott) alakváltozás létrehozására alkalmasak. Az alakváltozás, szemben más szerkezeti





Rugalmas állandók mérése (2-es számú mérés) mérési jegyzõkönyv

Rugalmas állandók mérése (2-es számú mérés) mérési jegyzõkönyv (-es számú mérés) mérési jegyzõkönyv Készítette:,... Beadás ideje:.. 9. /9 A mérés leírása: A mérés során különbözõ alakú és anyagú rudak Young-moduluszát, valamint egy torziós szál torziómoduluszát akarjuk


Abszorpciós spektroszkópia

Abszorpciós spektroszkópia Tartalomjegyzék Abszorpciós spektroszkópia (Nyitrai Miklós; 2011 február 1.) Dolgozat: május 3. 18:00-20:00. Egész éves anyag. Korábbi dolgozatok nem számítanak bele. Felmentés 80% felett. A fény; Elektromágneses


MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére

MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére MedInProt Szinergia IV. program Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére Tantos Ágnes MTA TTK Enzimológiai Intézet, Rendezetlen fehérje kutatócsoport


10. Éneklő fűszál Egy fűszál, papírszalag vagy hasonló tárgy élére fújva hangot hozhatunk létre. Vizsgáld meg a jelenséget!

10. Éneklő fűszál Egy fűszál, papírszalag vagy hasonló tárgy élére fújva hangot hozhatunk létre. Vizsgáld meg a jelenséget! 3. Mesterséges izom: Erősíts polimer horgászzsinórt egy elektromos fúróra, majd a fúróval feszíts meg a zsinórt. Ahogy csavarodik a zsinór rugó-szerű elrendezésben feszes spirálokat képez. Hő közlésével


Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,


Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet

Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás -amőboid - csillós - kontrakció Sejt adhézió -sejt-ecm -sejt-sejt MOZGÁS A sejtmozgás


A doktori értekezés tézisei. A növényi NRP fehérjék lehetséges szerepe a hiszton defoszforiláció szabályozásában, és a hőstressz válaszban.

A doktori értekezés tézisei. A növényi NRP fehérjék lehetséges szerepe a hiszton defoszforiláció szabályozásában, és a hőstressz válaszban. A doktori értekezés tézisei A növényi NRP fehérjék lehetséges szerepe a hiszton defoszforiláció szabályozásában, és a hőstressz válaszban. Bíró Judit Témavezető: Dr. Fehér Attila Magyar Tudományos Akadémia


19.Budapest Nephrologiai Iskola/19th Budapest Nephrology School angol 44 6 napos

19.Budapest Nephrologiai Iskola/19th Budapest Nephrology School angol 44 6 napos Elméleti Orvostudományok Doktori Iskola 3 éves kurzus terve 2011/2012/ 2 félév - 2014/2015/1 félév 2011//2012 tavaszi félév Program sz. Kurzusvezető neve Kurzus címe magyarul/angolul Kurzus nyelve


Kecskeméti Főiskola GAMF Kar. Poliolefinek öregítő vizsgálata Szűcs András. Budapest, 2011. X. 18

Kecskeméti Főiskola GAMF Kar. Poliolefinek öregítő vizsgálata Szűcs András. Budapest, 2011. X. 18 Kecskeméti Főiskola GAMF Kar Poliolefinek öregítő vizsgálata Szűcs András Budapest, 211. X. 18 1 Tartalom Műanyagot érő öregítő hatások Alapanyag és minta előkészítés Vizsgálati berendezések Mérési eredmények


Diabéteszes redox változások hatása a stresszfehérjékre

Diabéteszes redox változások hatása a stresszfehérjékre Semmelweis Egyetem Molekuláris Orvostudományok Tudományági Doktori Iskola Pathobiokémia Program Doktori (Ph.D.) értekezés Diabéteszes redox változások hatása a stresszfehérjékre dr. Nardai Gábor Témavezeto:


Jegyzőkönyv. mágneses szuszceptibilitás méréséről (7)

Jegyzőkönyv. mágneses szuszceptibilitás méréséről (7) Jegyzőkönyv a mágneses szuszceptibilitás méréséről (7) Készítette: Tüzes Dániel Mérés ideje: 8-1-1, szerda 14-18 óra Jegyzőkönyv elkészülte: 8-1-8 A mérés célja A feladat egy mágneses térerősségmérő eszköz


Tudjunk Egymásról Bugyi Beáta 22/11/2012

Tudjunk Egymásról Bugyi Beáta 22/11/2012 Listeria monocytogenes Loisel, Boujemaa et al. Nature 1999 Összetett aktin hálózatok Spire/formin szinergia Reymann et al. Nature Materials 1 ADF/aktin Bosch, Bugyi B et al. Molecular Cell 7 Reymann et


ahol m-schmid vagy geometriai tényező. A terhelőerő növekedésével a csúszó síkban fellép az un. kritikus csúsztató feszültség τ

ahol m-schmid vagy geometriai tényező. A terhelőerő növekedésével a csúszó síkban fellép az un. kritikus csúsztató feszültség τ Egykristály és polikristály képlékeny alakváltozása A Frenkel féle modell, hibátlan anyagot feltételezve, nagyon nagy folyáshatárt eredményez. A rácshibák, különösen a diszlokációk jelenléte miatt a tényleges


Modern fizika laboratórium

Modern fizika laboratórium Modern fizika laboratórium Röntgen-fluoreszcencia analízis Készítette: Básti József és Hagymási Imre 1. Bevezetés A röntgen-fluoreszcencia analízis (RFA) egy roncsolásmentes anyagvizsgálati módszer. Rövid


Ph.D. értekezés tézisei. Dürgő Hajnalka. Témavezető: Dr. Medzihradszky-Fölkl Katalin. Biológia Doktori Iskola. MTA SZBK Biokémiai Intézet SZTE TTIK

Ph.D. értekezés tézisei. Dürgő Hajnalka. Témavezető: Dr. Medzihradszky-Fölkl Katalin. Biológia Doktori Iskola. MTA SZBK Biokémiai Intézet SZTE TTIK Gümő-specifikus NCR peptidek azonosítása, vad és mutáns Medicago truncatula gyökérgümők összehasonlító fehérjeanalízise, és az NCR247 lehetséges bakteriális interakciós partnereinek felderítése Ph.D. értekezés


A vérképző rendszerben ionizáló sugárzás által okozott mutációk kialakulásának numerikus modellezése

A vérképző rendszerben ionizáló sugárzás által okozott mutációk kialakulásának numerikus modellezése A vérképző rendszerben ionizáló sugárzás által okozott mutációk kialakulásának numerikus modellezése Madas Balázs Gergely XXXIX. Sugárvédelmi Továbbképző Tanfolyam Hajdúszoboszló, Hunguest Hotel Béke 2014.


Komplex hálózatok moduláris szerkezete

Komplex hálózatok moduláris szerkezete Az OTKA K68669 azonosítójú, Komplex hálózatok moduláris szerkezete című pályázat szakmai beszámolója 1. Bevezetés Az utóbbi évtizedben a hálózati megközelítés több fontos sikert hozott biológiai, technológiai,


Rendezetlen kondenzált fázisok tulajdonságainak vizsgálata számítógépes szimulációs módszerekkel

Rendezetlen kondenzált fázisok tulajdonságainak vizsgálata számítógépes szimulációs módszerekkel Rendezetlen kondenzált fázisok tulajdonságainak vizsgálata számítógépes szimulációs módszerekkel MTA doktori értekezés Írta: Jedlovszky Pál Eötvös Loránd Tudományegyetem Kémiai Intézet Budapest, 2006.


A fotoszintézis molekuláris biofizikája (Vass Imre, 2000) 39

A fotoszintézis molekuláris biofizikája (Vass Imre, 2000) 39 A fotoszintézis molekuláris biofizikája (Vass Imre, 2000) 39 6. A citokróm b 6 f komplex A két fotokémiai rendszer közötti elektrontranszportot a citokróm b 6 f komplex közvetíti. Funkciója a kétszeresen


Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az


ESR-spektrumok különbözı kísérleti körülmények között A számítógépes értékelés alapjai anizotróp kölcsönhatási tenzorok esetén

ESR-spektrumok különbözı kísérleti körülmények között A számítógépes értékelés alapjai anizotróp kölcsönhatási tenzorok esetén ESR-spektrumok különbözı kísérleti körülmények között A számítógépes értékelés alapjai anizotróp kölcsönhatási tenzorok esetén A paraméterek anizotrópiája egykristályok rögzített tengely körüli forgatásakor


CD-spektroszkópia. Az ORD spektroskópia alapja

CD-spektroszkópia. Az ORD spektroskópia alapja CD-spektroszkópia Az ORD spektroskópia alapja - A XIX. század elején Biot megfigyelte, hogy bizonyos, a természetben előforduló szerves anyagok a lineárisan polarizált fény síkját elforgatják. - 1817-ben


Miért egyedi molekulák? Miért egyedi molekulák? Biomolekulák és sejtek mechanikai tulajdonságai. Élő sejtben: molekulagépezetek sokasága

Miért egyedi molekulák? Miért egyedi molekulák? Biomolekulák és sejtek mechanikai tulajdonságai. Élő sejtben: molekulagépezetek sokasága Élő sejtben: molekulagépezetek sokasága Biomolekulák és sejtek mechanikai tulajdonságai Tovakúszó keratinocita Mikrotubulus dinamikus instabilitás Kellermayer Miklós Semmelweis Egyetem Biofizikai és Sugárbiológiai


Dózis-válasz görbe A dózis válasz kapcsolat ábrázolása a legáltalánosabb módja annak, hogy bemutassunk eredményeket a tudományban vagy a klinikai

Dózis-válasz görbe A dózis válasz kapcsolat ábrázolása a legáltalánosabb módja annak, hogy bemutassunk eredményeket a tudományban vagy a klinikai Dózis-válasz görbe A dózis válasz kapcsolat ábrázolása a legáltalánosabb módja annak, hogy bemutassunk eredményeket a tudományban vagy a klinikai gyakorlatban. Például egy kísérletben növekvő mennyiségű


Félvezetk vizsgálata

Félvezetk vizsgálata Félvezetk vizsgálata jegyzkönyv Zsigmond Anna Fizika BSc III. Mérés vezetje: Böhönyei András Mérés dátuma: 010. március 4. Leadás dátuma: 010. március 17. Mérés célja A mérés célja a szilícium tulajdonságainak


Rugalmas állandók mérése

Rugalmas állandók mérése KLASSZIKUS FIZIKA LABORATÓRIUM 2. MÉRÉS Rugalmas állandók mérése Mérést végezte: Enyingi Vera Atala ENVSAAT.ELTE Mérés időpontja: 2011. november 16. Szerda délelőtti csoport 1. A mérés rövid leírása Mérésem
