Dokkolás: mit, hogyan, mivel?

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "Dokkolás: mit, hogyan, mivel?"


1 Dokkolás: mit, hogyan, mivel? Grolmusz Vince egy. tan. ELTE Matematikai Intézet & Uratim Kft. Iván Gábor és Szabadka Zoltán

2 Áttekintés 1. (Bevezetés) 2. A receptorfehérje és a ligand modellezése 3. A kötési energia modellezése 4. Optimalizálás a ligand konformációs terében 5. A dokkolóalgoritmus értékelése 6. Dokkolás PC-kből álló klaszteren 7. (Összefoglalás)

3 Áttekintés 1. (Bevezetés) 2. A receptorfehérje és a ligand modellezése 3. A kötési energia modellezése 4. Optimalizálás a ligand konformációs terében 5. A dokkolóalgoritmus értékelése 6. Dokkolás PC-kből álló klaszteren 7. (Összefoglalás)

4 Bevezetés: In silico gyógyszerkutatás Virtuális gyógyszerkutatás: labor helyett számítógéppel. Ma még nem megy: Modellek (fehérje szerk.) nem pontosak; Módszerek: közelítőek, így pontatlanok Arra jó, hogy ötleteket adjon, illetve hogy szűkítse a vizsgálandó molekulák számát

5 Honnan szedjük a célpontokat? Konzultálunk biológusokkal, mit érdemes támadni (ezek többnyire fehérjék); fehérjét kódoló humán gén van, ennél több fehérje ma használt célpont van (!) Keresünk a fehérjehálózatban fontos célpontot (következő előadáson)

6 Célpont struktúrája: Fehérje 3D struktúra Legjobb forrás: A PDB (Protein Data Bank) Annotált változatok: PDBSum Wiki változat: PDB javító, elemző program:

7 Honnan szedjük a kismolekulákat? Jó lenne: valódi drogkönyvtárakból. Baj van: Nagy gyáraknak van ilyen; Kicsik azt állítják, hogy van nekik ilyen, de Miért nehéz fizikailag fenntartani több százezer molekulát?

8 Virtuális (in silico) könyvtárak Miért jó? Nem romlik meg, Könnyen megosztható Nem kell fizikailag megvenni, csak azt, ami jó. A leghíresebb ilyen a ZINC (UCSF, Shoichet Lab); 13 millió megvásárolható molekulát tartalmaz

9 A ZINC egy oldala

10 Bevezetés: a dokkolási feladat Adott: egy fehérje és egy kismolekula (ligand) háromdimenziós térszerkezete. Szeretnénk számítógépes szimulációval modellezni a fehérje és a ligand vizes oldatbeli kölcsönhatását: (1) megjósolni a fehérje-ligand komplex képződése során keletkező szabadenergia-változást, és (2) megjósolni a fehérje-ligand komplex térszerkezetét. Két alapvető részfeladat: Scoring : A ligand adott konformációjához egy energiaérték rendelése (a fehérjét merevnek fogjuk tekinteni) Dokkolás: A fenti energiafüggvény minimalizálása a ligand konformációinak terében

11 Áttekintés 1. (Bevezetés) 2. A receptorfehérje és a ligand modellezése 3. A kötési energia modellezése 4. Optimalizálás a ligand konformációs terében 5. A dokkolóalgoritmus értékelése 6. Dokkolás PC-kből álló klaszteren 7. (Összefoglalás)

12 A receptor és a ligand modellezése Receptoratomok attribútumai: Atom típusa: { H, C, N, O, S, P } Receptoratom koordinátái: 3D vektor Partial charge O és H atomokhoz további paraméterek az energiafüggvény hidrogénhíd-kötéseket modellező tagjához (nemkötő elektronpárok elhelyezkedése stb.) Ligand: Atomtípusok: { H, C, N, O, S, P, F, Cl, Br, I} Ligandatom koordinátái Kötések típusa: { forgatható, nem forgatható }; (hányszoros; aromás-e; ) forgatható kötések = amelyek legalább egy nehézatomot forgatnak, és mindkét végpontjuk legalább 2-fokú ponthoz (atomhoz) csatlakozik

13 Áttekintés 1. (Bevezetés) 2. A receptorfehérje és a ligand modellezése 3. A kötési energia modellezése 4. Optimalizálás a ligand konformációs terében 5. A dokkolóalgoritmus értékelése 6. Dokkolás PC-kből álló klaszteren 7. (Összefoglalás)

14 A dokkoláshoz használt energiafüggvény

15 A dokkoláshoz használt energiafüggvény 1.: Lennard-Jones potenciál Szumma: a fehérje és a ligand összes lehetséges nehézatompárjára (persze úgyis csak az egymáshoz aránylag közeliek számítanak) Szénatomhoz kapcsolódó H-atomok: külön atomtípusként Az L-J potenciál r ij -től, azaz a két atom távolságától függ Az A és B együtthatók értéke a két atomhoz tartozó van der Waals sugaraktól függ Kb.: hol legyen az L-J potenciálfv. minimumhelye

16 A dokkoláshoz használt energiafüggvény 2.: Hidrogénhíd-kötések Nagy elektronegativitású poláris atom ( = akceptor) és hidrogén, vagy más poláris atom ( = donor) között jön létre Erőssége nemcsak a résztvevő atomok távolságától, de a hidrogénhidat alkotó funkciós csoportok térbeli helyzetétől is függ Szögfüggő tényező A Lennard-Jones potenciálhoz hasonló függvény, annál gyorsabban konvergál a nullához + -ben

17 A dokkoláshoz használt energiafüggvény 3.: Elektrosztatikus kölcsönhatás q i, q j : partial charge : olyan pontszerű töltések, amelyeket az egyes atomok pozíciójában elhelyezve a keletkező elektrosztatikus tér jól közelíti a valósat Az oldószernek az elektrosztatikus potenciált befolyásoló hatása távolságfüggő dielektromos állandó bevezetésével vétetik figyelembe (ε), bővebben itt nem részletezzük

18 A dokkoláshoz használt energiafüggvény 4.: Torziós energia-tag A fehérjéhez való kötés során a kismolekula a fehérje-ligand komplex részévé válik, ezáltal a forgatható kötések általi szabadsági fokai elvesznek; a ligand egy jól definiált konformációban stabilizálódik A ligand entrópiája emiatt csökken; a csökkenés mértéke arányos a ligand adott energiaszinten lehetséges mikroállapotai számának logaritmusával Minden forgatható kötés háromféle stabil állapotban létezhet az entrópiaveszteség éppen a forgatható kötések számával arányos (az arányossági tényezőt pedig már belevettük a modellbe, azt itt nem kell még egyszer szerepeltetni)

19 A dokkoláshoz használt energiafüggvény 5.: Vízmolekulák aggregált figyelembe vétele Az oldatbeli szabadenergiaváltozást modellezi (anélkül, hogy minden egyes vízmolekulával egyenként számolnunk kellene) Szumma: a fehérje összes nehézatomjából és a ligand összes szénatomjából álló atompárra V i : fragmental volume (minden fehérjeatomhoz eltároltuk), S j : solvation parameter (minden ligandatomhoz rendelkezésre áll) A szummázás során a két fenti tényező szorzatát az aktuális atompár távolságának Gauss-függvényével súlyozzuk

20 A dokkoláshoz használt energiafüggvény 6.: A ligand belső energiája A ligand kovalens kötésekkel meghatározott geometriája a dokkolás során nem változik, így az alábbi szumma csak a ligand kovalensen nem kötő atompárjaira vonatkozik A ligand belső energiáját a molekulán belüli van der Waals kölcsönhatások összegével modellezzük: E i ( L) = i, j L A r ij 12 ij B r ij k ij

21 Az energiafüggvény előzetes számítása háromdimenziós rácson Mivel a fehérjét merevnek fogjuk majd tekinteni, elegendő lesz az alábbi 3D-s potenciálfüggvényeket egy 3D-s rács (grid) rácspontjaiban kiszámítanunk: E t P (x) : egyetlen ligandatomnak a teljes fehérjével való interakciójának energiája (minden lehetséges ligandatomtípusra kiszámoljuk ez kb. 10 atomtípus) Q P (x) : elektrosztatikus potenciál a fehérje környezetében A fenti mennyiségek használatával az energiafüggvény az alábbi alakba írható: E( P, L) = j L ( ) t EP ( x j ) + q jqp ( x j ) + Etor Ntor j

22 Az energiafüggvény előzetes számítása háromdimenziós rácson A rácson mintavételezett értékekből a függvényeket harmadrendű B-spline approximációval közelítjük (később részletesebben), ennek előnyei: Egy adott helyen (=ligandkonformációban) való kiértékeléshez csak kb. 100 szorzás több tízezer helyett Az energiafüggvényt ezzel egyszersmind kétszer folytonosan differenciálhatóvá tesszük Ezen kívül figyelembe kell venni a ligand belső energiáját is (már utaltunk rá, van der Waals-jellegű): E i ( L) = i, j L A r ij 12 ij B r ij k ij

23 A 3D rács (grid ) rácspontjai közötti függvényértékek approximálása

24 B-spline approximáció

25 B-spline approximáció Az f függvényt egyenletes lépésközzel mintavételezzük, és a mintavételezési pontok között a bázisfüggvények segítségével (jobb oldali ábra ) approximáljuk Mivel az l lépésköz állandó, az (egyelőre egydimenziós) f függvényünket egyenletesen mintavételezzük; ekkor uniform B- spline approximációról beszélünk. A B-spline-nal approximált függvény:

26 Harmadrendű uniform B-spline approximáció

27 Áttekintés 1. (Bevezetés) 2. A receptorfehérje és a ligand modellezése 3. A kötési energia modellezése 4. Optimalizálás a ligand konformációs terében 5. A dokkolóalgoritmus értékelése 6. Dokkolás PC-kből álló klaszteren 7. (Összefoglalás)

28 A ligand konformációs terének paraméterezése A célfüggvény független változói (n+6 dimenziós*): x 0, y 0, z 0 φ 0, ψ 0, θ 0 φ 1, φ 2,, φ n A ligand helyvektora A ligand orientációját jellemző szögek A ligand forgatható kötései menti torziós szögek F( x) = Eˆ( P, L( x)) + E i ( L( x)) i E ( L) = i, j L A rij ij 12 B ij 6 ij r *: A továbbiakban a függvény dimenziószámát n -nel jelöljük

29 Egy lokális optimalizáló algoritmus általános struktúrája Bemenet: a függvény és a tér egy pontja Ciklus: Leállási feltétel: Választunk egy irányt Az aktuális pontból ebben az irányban végzünk egy 1D-s minimalizálást Az új pont az így megtalált minimum lesz Amíg a gradiensvektor normája elég kicsi nem lesz

30 Egy lokális optimalizáló algoritmus általános struktúrája Bemenet: a függvény és a tér egy pontja (a kiindulópont) Inicializálás: Ciklus: Leállási feltétel: p x g p g 0 = g 0 = f x k + 1 k + 1 k + 1 = x k = f = g k α p k ( x k + 1 k k ) + β p 1 < f 1 f ( x) k + ε + ( 0 ) k

31 Lokális optimalizálás konjugált gradiens módszer(ek)kel Konjugált gradiens módszer (CGM): speciális lokális optimalizáló algoritmus, melynél az irányparamétert (β) az alábbiak szerint számoljuk ki (~korábbi irányt minden n+1-edik lépésben elfelejtjük): Tétel (Fletcher, Rieves): ha az optimalizálásban részt vevő függvényünk kvadratikus, és a lépésköz paraméterét (α) úgy választjuk meg, hogy a keresési irányok páronként ortogonálisak legyenek, akkor a CGM algoritmus legfeljebb n Lépésben megtalálja a lokális optimumot. ( Lépés = n db lépés ) Jelentősége: A B-spline-okkal approximált energiafüggvényünk kétszer folytonosan differenciálható a minimum környezetében Taylor-sorba fejthető az algoritmusunk gyorsan konvergál majd a lokális optimumhoz

32 A globális optimum megtalálásához használt heurisztikák Multi-Start (MS): véletlenszerűen sorsolt (mondjuk 1000 darab) ligandkonformációkkal indítjuk a lokális optimalizálást, és végeredményként a legkisebb energiájú megtalált lokális optimumot jelenítjük meg. Kompetitív Multi-Start (CMS): A MS kiegészítése az alábbi heurisztikákkal: Csak néhány lépést engedünk meg lefutni a lokális optimalizálásokból Az aktuális konformációkat rendezzük energia szerint, és csak a legkisebb energiájú 10 %-ukat tartjuk meg Erre a 10%-ra tovább futtatjuk a lokális optimalizálást 10- szer több lépésben Ha már csak egy konformáció marad, megállunk

33 Áttekintés 1. (Bevezetés) 2. A receptorfehérje és a ligand modellezése 3. A kötési energia modellezése 4. Optimalizálás a ligand konformációs terében 5. A dokkolóalgoritmus értékelése 6. Dokkolás PC-kből álló klaszteren 7. (Összefoglalás)

34 A dokkolóprogram értékelése II.: A teszthalmaz validálása A fehérje-ligand komplex teszthalmazban szereplő konformációja A fehérje-ligand komplex valós konformációja: homodimer fehérje

35 Áttekintés 1. (Bevezetés) 2. A receptorfehérje és a ligand modellezése 3. A kötési energia modellezése 4. Optimalizálás a ligand konformációs terében 5. A dokkolóalgoritmus értékelése 6. Dokkolás PC-kből álló klaszteren 7. (Összefoglalás)

36 Az in-silico screening munkafolyamat 3D fehérje-térszerkezet (PDB formátumban) Fehérje előkészítése Receptor specification file Dokkolóalgoritmus B-spline approx. Globális keresés Lokális optimalizálás ZINC kismolekulaadatbázis (2-5 millió ligand) Energiaszámítás Legjobb 1000 ligand 3D energia-rács (grid) Oldhatóság jóslása Inhibitor-jelöltek

37 A dokkolóprogram párhuzamos futtatása I. Egy kismolekula dokkolása: néhány perc A jelenleg használt kismolekula-adatbázis (ZINC7.purchasable) mérete: kb. 2.5 millió kismolekula A dokkolóprogramot párhuzamosan futtatjuk egy tetszőleges számú és földrajzi helyű PC-t tartalmazó klaszteren: Előre kiszámoljuk:.pdb.rsf grid Egyetlen központi szerver vezérli a dokkolást: grid és feladatok kiosztása, eredmények begyűjtése, dokkoló PC-k állapotának figyelése Utófeldolgozás: energia újraszámolása az eredeti energiafüggvénnyel, a legjobb k találat konformációjának legyártása.pdb formátumban

38 A dokkolóprogram párhuzamos futtatása II. A dokkolást felügyelő gép ( MySQL adatbázisban nyilvántartja A teljes ZINC7 adatbázist A dokkolásra előkészített gépek IP címét, processzormagok számát, állapotát Dokkolási eredményeket A dokkolást befolyásoló paraméterek (nem teljes lista): Lokális optimalizáláshoz sorsolt kezdőpozíciók száma Véletlen kezdőpozíciók sorsolásához használt véletlenszámgenerátort inicializáló szám (seed) (elméletben legalábbis) reprodukálható eredmények Mely ligandok szerepeljenek a dokkolásban Mely gépek dokkoljanak Az energiafüggvény együtthatói ( stb.)


40 Néhány eredmény Találatok az MTB Phosphoribosyl Isomerase enzimén (PDB kód: 2bnt) Találat az MTB dutp diphosphatase enzimjén

41 Áttekintés 1. (Bevezetés) 2. A receptorfehérje és a ligand modellezése 3. A kötési energia modellezése 4. Optimalizálás a ligand konformációs terében 5. A dokkolóalgoritmus értékelése 6. Dokkolás PC-kből álló klaszteren 7. (Összefoglalás)

42 További gondok: Hardver elavul Megvannak a jó molekula-találatok a ZINC-ből. Ezt meg kell rendelni. Lehet, hogy nem tudnak szállítani; Szállítanak, de nem azt, vagy nem elég jó tisztaságban; Nem árt, ha van szintetikus kémiai háttér, és analitika is

43 Ha komoly molekuláink vannak: Jó minőségben, aránylag nagy mennyiségben gyártani kell; Elsődleges farmakológiai, hatásvizsgálatok: pár tíz mg; Pre-klinika: akár pár kg kell! Itt már nem virtuális világ van

44 Köszönöm a figyelmet!

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis Szerkezet Protein Data Bank (PDB) ~ 35 701 szerkezet közepes felbontás 1552 szerkezet d 1.5 Å 160 szerkezet d 1.0 Å 10 szerkezet d 0.8 Å (atomi felbontás) E globális minimum? funkció


Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések

Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Pécsi Tudományegyetem Általános Orvostudományi Kar 2010-2011. 1 A vegyületekben az atomokat kémiai kötésnek nevezett erők tartják össze. Az elektronok


Felhő használata mindennapi alkalmazások futtatására. Németh Zsolt MTA SZTAKI

Felhő használata mindennapi alkalmazások futtatására. Németh Zsolt MTA SZTAKI Felhő használata mindennapi alkalmazások futtatására Németh Zsolt MTA SZTAKI Legyőzni a maláriát 45 másodpercenként meghal egy gyerek maláriában Évente 216 millió ember fertőződik meg és 650000 meghal


A kovalens kötés polaritása

A kovalens kötés polaritása Általános és szervetlen kémia 4. hét Kovalens kötés A kovalens kötés kialakulásakor szabad atomokból molekulák jönnek létre. A molekulák létrejötte mindig energia csökkenéssel jár. A kovalens kötés polaritása


Számítógépes döntéstámogatás. Genetikus algoritmusok

Számítógépes döntéstámogatás. Genetikus algoritmusok BLSZM-10 p. 1/18 Számítógépes döntéstámogatás Genetikus algoritmusok Werner Ágnes Villamosmérnöki és Információs Rendszerek Tanszék e-mail: BLSZM-10 p. 2/18 Bevezetés 1950-60-as


Kötések kialakítása - oktett elmélet

Kötések kialakítása - oktett elmélet Kémiai kötések Az elemek és vegyületek halmazai az atomok kapcsolódásával - kémiai kötések kialakításával - jönnek létre szabad atomként csak a nemesgázatomok léteznek elsődleges kémiai kötések Kötések


Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok

Atomszerkezet. Atommag protonok, neutronok + elektronok. atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok Atomszerkezet Atommag protonok, neutronok + elektronok izotópok atompályák, alhéjak, héjak, atomtörzs ---- vegyérték elektronok periódusos rendszer csoportjai Periódusos rendszer A kémiai kötés Kémiai


A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR)

A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR) 4. előadás A kovalens kötés elmélete Vegyértékelektronpár taszítási elmélet (VSEPR) az atomok kötő és nemkötő elektronpárjai úgy helyezkednek el a térben, hogy egymástól minél távolabb legyenek A központi


10. Előadás. 1. Feltétel nélküli optimalizálás: Az eljárás alapjai

10. Előadás. 1. Feltétel nélküli optimalizálás: Az eljárás alapjai Optimalizálási eljárások MSc hallgatók számára 10. Előadás Előadó: Hajnal Péter Jegyzetelő: T. Szabó Tamás 2011. április 20. 1. Feltétel nélküli optimalizálás: Az eljárás alapjai A feltétel nélküli optimalizálásnál


Kémiai kötések. Kémiai kötések. A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011

Kémiai kötések. Kémiai kötések. A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 Kémiai kötések A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 Cl + Na Az ionos kötés 1. Cl + - + Na Klór: 1s 2 2s 2 2p 6 3s 2 3p 5 Kloridion: 1s2 2s2 2p6 3s2 3p6 Nátrium: 1s 2 2s


Molekuláris dinamika. 10. előadás

Molekuláris dinamika. 10. előadás Molekuláris dinamika 10. előadás Mirőlis szól a MD? nagy részecskeszámú rendszerek ismerjük a törvényeket mikroszkópikus szinten? Hogyan tudjuk megérteni a folyadékok, gázok, szilárdtestek makroszkópikus


"A tízezer mérföldes utazás is egyetlen lépéssel kezdődik."

A tízezer mérföldes utazás is egyetlen lépéssel kezdődik. "A tízezert mérföldes utazás is egyetlen lépéssel kezdődik dik." A BINB INSYS Előadók: Kornafeld Ádám SYS PROJEKT Ádám MTA SZTAKI Kovács Attila ELTE IK Társszerzők:


Vegyületek - vegyületmolekulák

Vegyületek - vegyületmolekulák Vegyületek - vegyületmolekulák 3.Az anyagok csoportosítása összetételük szerint Egyszerű összetett Azonos atomokból állnak különböző atomokból állnak Elemek vegyületek keverékek Fémek Félfémek Nemfémek


Nemlineáris egyenletrendszerek megoldása április 15.

Nemlineáris egyenletrendszerek megoldása április 15. Nemlineáris egyenletrendszerek megoldása 2014. április 15. Nemlineáris egyenletrendszerek Az egyenletrendszer a következő formában adott: f i (x 1, x 2,..., x M ) = 0 i = 1...N az f i függvények az x j


1. Olvassuk be két pont koordinátáit: (x1, y1) és (x2, y2). Határozzuk meg a két pont távolságát és nyomtassuk ki.

1. Olvassuk be két pont koordinátáit: (x1, y1) és (x2, y2). Határozzuk meg a két pont távolságát és nyomtassuk ki. Számítás:. Olvassuk be két pont koordinátáit: (, y) és (2, y2). Határozzuk meg a két pont távolságát és nyomtassuk ki. 2. Olvassuk be két darab két dimenziós vektor komponenseit: (a, ay) és (b, by). Határozzuk


Matematikai modellezés

Matematikai modellezés Matematikai modellezés Bevezető A diasorozat a Döntési modellek című könyvhöz készült. Készítette: Dr. Ábrahám István Döntési folyamatok matematikai modellezése Az emberi tevékenységben meghatározó szerepe


Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n. 2008. április 29.

Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n. 2008. április 29. Modern Fizika Labor Fizika BSc A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n Értékelés: A beadás dátuma: 2008. május 6. A mérést végezte: 1/5 A mérés célja A mérés célja az


Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól

Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól Ragyogó molekulák: dióhéjban a fluoreszcenciáról és biológiai alkalmazásairól Kele Péter egyetemi adjunktus Lumineszcencia jelenségek Biolumineszcencia (biológiai folyamat, pl. luciferin-luciferáz) Kemilumineszcencia


Kémiai alapismeretek 3. hét

Kémiai alapismeretek 3. hét Kémiai alapismeretek 3. hét Horváth Attila Pécsi Tudományegyetem, Természettudományi Kar, Kémia Intézet, Szervetlen Kémiai Tanszék 2013. szeptember 17.-20. 1/15 2013/2014 I. félév, Horváth Attila c : Molekulákon


ESR-spektrumok különbözı kísérleti körülmények között A számítógépes értékelés alapjai anizotróp kölcsönhatási tenzorok esetén

ESR-spektrumok különbözı kísérleti körülmények között A számítógépes értékelés alapjai anizotróp kölcsönhatási tenzorok esetén ESR-spektrumok különbözı kísérleti körülmények között A számítógépes értékelés alapjai anizotróp kölcsönhatási tenzorok esetén A paraméterek anizotrópiája egykristályok rögzített tengely körüli forgatásakor


Adatgyűjtés, mérési alapok, a környezetgazdálkodás fontosabb műszerei

Adatgyűjtés, mérési alapok, a környezetgazdálkodás fontosabb műszerei Tudományos kutatásmódszertani, elemzési és közlési ismeretek modul Gazdálkodási modul Gazdaságtudományi ismeretek I Közgazdasá Adatgyűjtés, mérési alapok, a környezetgazdálkodás fontosabb műszerei KÖRNYEZETGAZDÁLKODÁSI


Az anyagi rendszer fogalma, csoportosítása

Az anyagi rendszer fogalma, csoportosítása Az anyagi rendszer fogalma, csoportosítása A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 1 A rendszer fogalma A körülöttünk levő anyagi világot atomok, ionok, molekulák építik


A Jövő Internet elméleti alapjai. Vaszil György Debreceni Egyetem, Informatikai Kar

A Jövő Internet elméleti alapjai. Vaszil György Debreceni Egyetem, Informatikai Kar A Jövő Internet elméleti alapjai Vaszil György Debreceni Egyetem, Informatikai Kar Kutatási témák Bizalmas adatok védelme, kriptográfiai protokollok DE IK Számítógéptudományi Tsz., MTA Atomki Informatikai


Panorámakép készítése

Panorámakép készítése Panorámakép készítése Képregisztráció, 2009. Hantos Norbert Blaskovics Viktor Összefoglalás Panoráma (image stitching, planar mosaicing): átfedő képek összeillesztése Lépések: Előfeldolgozás (pl. intenzitáskorrekciók)


T I T - M T T. Hevesy György Kémiaverseny. A megyei forduló feladatlapja. 7. osztály. A versenyző jeligéje:... Megye:...

T I T - M T T. Hevesy György Kémiaverseny. A megyei forduló feladatlapja. 7. osztály. A versenyző jeligéje:... Megye:... T I T - M T T Hevesy György Kémiaverseny A megyei forduló feladatlapja 7. osztály A versenyző jeligéje:... Megye:... Elért pontszám: 1. feladat:... pont 2. feladat:... pont 3. feladat:... pont 4. feladat:...


Az elektronpályák feltöltődési sorrendje

Az elektronpályák feltöltődési sorrendje 3. előadás 12-09-17 2 12-09-17 Az elektronpályák feltöltődési sorrendje 3 Az elemek rendszerezése, a periódusos rendszer Elsőként Dimitrij Ivanovics Mengyelejev és Lothar Meyer vette észre az elemek halmazában


Akusztikai tervezés a geometriai akusztika módszereivel

Akusztikai tervezés a geometriai akusztika módszereivel Akusztikai tervezés a geometriai akusztika módszereivel Fürjes Andor Tamás BME Híradástechnikai Tanszék Kép- és Hangtechnikai Laborcsoport, Rezgésakusztika Laboratórium 1 Tartalom A geometriai akusztika


Elektrosztatikus modell fragmens méretű ligandumok fehérje komplexeinek vizsgálatára

Elektrosztatikus modell fragmens méretű ligandumok fehérje komplexeinek vizsgálatára Elektrosztatikus modell fragmens méretű ligandumok fehérje komplexeinek vizsgálatára Szakdolgozat Vegyész Mesterszak KISS DÓRA JUDIT Témavezető: Dr. Ferenczy György MTA TTK Gyógyszerkémiai Kutatócsoport


Lagrange egyenletek. Úgy a virtuális munka mint a D Alembert-elv gyakorlati alkalmazását

Lagrange egyenletek. Úgy a virtuális munka mint a D Alembert-elv gyakorlati alkalmazását Lagrange egyenletek Úgy a virtuális munka mint a D Alembert-elv gyakorlati alkalmazását megnehezíti a δr i virtuális elmozdulások egymástól való függősége. (F i ṗ i )δx i = 0, i = 1, 3N. (1) i 3N infinitezimális


Számítógép és programozás 2

Számítógép és programozás 2 Számítógép és programozás 2 11. Előadás Halmazkeresések, dinamikus programozás A keresési feladat megoldása Legyen a lehetséges megoldások halmaza M ciklus { X legyen


Spektroszkópiai módszerek 2.

Spektroszkópiai módszerek 2. Spektroszkópiai módszerek 2. NMR spektroszkópia magspinek rendeződése külső mágneses tér hatására az eredő magspin nem nulla, ha a magot alkotó nukleonok közül legalább az egyik páratlan a szerves kémiában


Fizikai kémia 2. Előzmények. A Lewis-féle kötéselmélet A VB- és az MO-elmélet, a H 2+ molekulaion

Fizikai kémia 2. Előzmények. A Lewis-féle kötéselmélet A VB- és az MO-elmélet, a H 2+ molekulaion 06.07.5. Fizikai kémia. 4. A VB- és az -elmélet, a H + molekulaion Dr. Berkesi ttó ZTE Fizikai Kémiai és Anyagtudományi Tanszéke 05 Előzmények Az atomok szerkezetének kvantummehanikai leírása 90-30-as


Cikloalkánok és származékaik konformációja

Cikloalkánok és származékaik konformációja 1 ikloalkánok és származékaik konformációja telített gyűrűs szénhidrogének legegyszerűbb képviselője a ciklopropán. Gyűrűje szabályos háromszög alakú, ennek megfelelően szénatomjai egy síkban helyezkednek


Miért jó nekünk kutatóknak a felhő? Kacsuk Péter MTA SZTAKI

Miért jó nekünk kutatóknak a felhő? Kacsuk Péter MTA SZTAKI Miért jó nekünk kutatóknak a felhő? Kacsuk Péter MTA SZTAKI Szolgáltatások halmaza: o Erőforrások, alkalmazások, eszközök o Nagy méretű, heterogén, gazdaságos, mobil, zöld El van takarva, hogy o Hol van


Többváltozós, valós értékű függvények

Többváltozós, valós értékű függvények Többváltozós függvények Többváltozós, valós értékű függvények Többváltozós függvények Definíció: többváltozós függvények Azokat a függvényeket, melyeknek az értelmezési tartománya R n egy részhalmaza,



KÖSZÖNTJÜK HALLGATÓINKAT! 2010. november 10. KÖSZÖNTJÜK HALLGATÓINKAT! Önök Dr. Horváth Zoltán Módszerek, amelyek megváltoztatják a világot A számítógépes szimuláció és optimalizáció jelentősége c. előadását hallhatják! 1 Módszerek,


Kémiai kötés Lewis elmélet

Kémiai kötés Lewis elmélet Kémiai kötés 10-1 Lewis elmélet 10-2 Kovalens kötés: bevezetés 10-3 Poláros kovalens kötés 10-4 Lewis szerkezetek 10-5 A molekulák alakja 10-6 Kötésrend, kötéstávolság 10-7 Kötésenergiák Általános Kémia,


Ellenőrző kérdések. 36. Ha t szintű indexet használunk, mennyi a keresési költség blokkműveletek számában mérve? (1 pont) log 2 (B(I (t) )) + t

Ellenőrző kérdések. 36. Ha t szintű indexet használunk, mennyi a keresési költség blokkműveletek számában mérve? (1 pont) log 2 (B(I (t) )) + t Ellenőrző kérdések 2. Kis dolgozat kérdései 36. Ha t szintű indexet használunk, mennyi a keresési költség blokkműveletek számában mérve? (1 pont) log 2 (B(I (t) )) + t 37. Ha t szintű indexet használunk,


A fehérjék térszerkezetének jóslása (Szilágyi András, MTA Enzimológiai Intézete)

A fehérjék térszerkezetének jóslása (Szilágyi András, MTA Enzimológiai Intézete) A fehérjék térszerkezetének jóslása (Szilágyi András, MTA Enzimológiai Intézete) A probléma bonyolultsága Általánosságban: találjuk meg egy tetszőleges szekvencia azon konformációját, amely a szabadentalpia


Digitális képek feldolgozása Előfeldolgozás Radiometriai korrekció Geometriai korrekció Képjavítás Szűrők Sávok közötti műveletek Képosztályozás Utófe

Digitális képek feldolgozása Előfeldolgozás Radiometriai korrekció Geometriai korrekció Képjavítás Szűrők Sávok közötti műveletek Képosztályozás Utófe Távérzékelés Digitális felvételek előfeldolgozása (EENAFOTOTV, ETNATAVERV) Erdőmérnöki szak, Környezettudós szak Király Géza NyME, Erdőmérnöki Kar Geomatikai, Erdőfeltárási és Vízgazdálkodási Intézet Földmérési


Görbe- és felületmodellezés. Szplájnok Felületmodellezés

Görbe- és felületmodellezés. Szplájnok Felületmodellezés Görbe- és felületmodellezés Szplájnok Felületmodellezés Spline (szplájn) Spline: Szakaszosan, parametrikus polinomokkal leírt görbe A spline nevét arról a rugalmasan hajlítható vonalzóról kapta, melyet


1 Műszaki hőtan Termodinamika. Ellenőrző kérdések-02 1

1 Műszaki hőtan Termodinamika. Ellenőrző kérdések-02 1 1 Műszaki hőtan Termodinamika. Ellenőrző kérdések-02 1 Kérdések. 1. Mit mond ki a termodinamika nulladik főtétele? Azt mondja ki, hogy mindenegyes termodinamikai kölcsönhatáshoz tartozik a TDR-nek egyegy


3. ZH-ban a minimum pontszám 15

3. ZH-ban a minimum pontszám 15 1. HF 2. HF 3. HF 4. HF 5. HF 1. ZH 2. ZH 3. ZH Osszesen Jegy EHA kod 4 4 4 4 4 4 4 4 18 10 10 30 100 1 ARAPAFP.PTE 3.5 2.5 4 4 2 4 4 2 15 5 6 18 70 3 x 2 BAMPACP.PTE 4 4 4 4 4 4 4 4 18 10 8 26 94 5 x



FEGYVERNEKI SÁNDOR, Valószínűség-sZÁMÍTÁs És MATEMATIKAI FEGYVERNEKI SÁNDOR, Valószínűség-sZÁMÍTÁs És MATEMATIKAI statisztika 10 X. SZIMULÁCIÓ 1. VÉLETLEN számok A véletlen számok fontos szerepet játszanak a véletlen helyzetek generálásában (pénzérme, dobókocka,


Monte Carlo módszerek a statisztikus fizikában. Az Ising modell. 8. előadás

Monte Carlo módszerek a statisztikus fizikában. Az Ising modell. 8. előadás Monte Carlo módszerek a statisztikus fizikában. Az Ising modell. 8. előadás Démon algoritmus az ideális gázra időátlag fizikai mennyiségek átlagértéke sokaságátlag E, V, N pl. molekuláris dinamika Monte


Tartalomjegyzék. Tartalomjegyzék... 3 Előszó... 9

Tartalomjegyzék. Tartalomjegyzék... 3 Előszó... 9 ... 3 Előszó... 9 I. Rész: Evolúciós számítások technikái, módszerei...11 1. Bevezetés... 13 1.1 Evolúciós számítások... 13 1.2 Evolúciós algoritmus alapfogalmak... 14 1.3 EC alkalmazásokról általában...


Matematikai geodéziai számítások 5.

Matematikai geodéziai számítások 5. Matematikai geodéziai számítások 5 Hibaterjedési feladatok Dr Bácsatyai László Matematikai geodéziai számítások 5: Hibaterjedési feladatok Dr Bácsatyai László Lektor: Dr Benedek Judit Ez a modul a TÁMOP


MTA Cloud Use cases MTA Cloud workshop. Hernáth Szabolcs MTA WIGNER FK

MTA Cloud Use cases MTA Cloud workshop. Hernáth Szabolcs MTA WIGNER FK MTA Cloud Use cases MTA Cloud workshop Hernáth Szabolcs MTA WIGNER FK IT felhasználás dimenziói Felhasználók száma / jellege Kapacitás mérete / jellege Számítási feladat / szoftverkörnyezet Adatok mérete


Dr. habil. Maróti György



A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.


Az elektromos kettősréteg. Az elektromos potenciálkülönbség eredete, értéke és az azt befolyásoló tényezők. Kolloidok stabilitása.

Az elektromos kettősréteg. Az elektromos potenciálkülönbség eredete, értéke és az azt befolyásoló tényezők. Kolloidok stabilitása. Az elektromos kettősréteg. Az elektromos potenciálkülönbség eredete, értéke és az azt befolyásoló tényezők. Kolloidok stabilitása. Adszorpció oldatból szilárd felületre Adszorpció oldatból Nem-elektrolitok


A periódusos rendszer, periodikus tulajdonságok

A periódusos rendszer, periodikus tulajdonságok A periódusos rendszer, periodikus tulajdonságok Szalai István ELTE Kémiai Intézet 1/45 Az előadás vázlata ˆ Ismétlés ˆ Történeti áttekintés ˆ Mengyelejev periódusos rendszere ˆ Atomsugár, ionsugár ˆ Ionizációs



KÉMIA ÍRÁSBELI ÉRETTSÉGI- FELVÉTELI FELADATOK 1995 JAVÍTÁSI ÚTMUTATÓ 1 oldal KÉMIA ÍRÁSBELI ÉRETTSÉGI- FELVÉTELI FELADATOK 1995 JAVÍTÁSI ÚTMUTATÓ I A VÍZ - A víz molekulája V-alakú, kötésszöge 109,5 fok, poláris kovalens kötések; - a jég molekularácsos, tetraéderes elrendeződés,


Skalárszorzat, norma, szög, távolság. Dr. Takách Géza NyME FMK Informatikai Intézet takach/ 2005.

Skalárszorzat, norma, szög, távolság. Dr. Takách Géza NyME FMK Informatikai Intézet takach/ 2005. 1 Diszkrét matematika II., 4. el adás Skalárszorzat, norma, szög, távolság Dr. Takách Géza NyME FMK Informatikai Intézet takach/ 2005. március 1 A téma jelent sége


Biológiai makromolekulák szerkezete

Biológiai makromolekulák szerkezete Biológiai makromolekulák szerkezete Biomolekuláris nemkovalens kölcsönhatások Elektrosztatikus kölcsönhatások (sóhidak: 4-6 kcal/m, dipól-dipól: ~10-1 kcal/m Diszperziós erők (~10-2 kcal/m) Hidrogén hidak


Alap-ötlet: Karl Friedrich Gauss ( ) valószínűségszámítási háttér: Andrej Markov ( )

Alap-ötlet: Karl Friedrich Gauss ( ) valószínűségszámítási háttér: Andrej Markov ( ) Budapesti Műszaki és Gazdaságtudományi Egyetem Gépészmérnöki Kar Hidrodinamikai Rendszerek Tanszék, Budapest, Műegyetem rkp. 3. D ép. 334. Tel: 463-6-80 Fa: 463-30-9 Alap-ötlet:


Facultatea de Chimie și Inginerie Chimică, Universitatea Babeș-Bolyai Admitere 2015

Facultatea de Chimie și Inginerie Chimică, Universitatea Babeș-Bolyai Admitere 2015 1. Az energiaszintek elektronokkal való feltöltésére vonatkozó kijelentések közül melyik igaz? A. A 3. héj maximum 8 elektront tartalmazhat. B. A 3d alhéj elektronokkal való feltöltése a 4s alhéj előtt


FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino



TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL Az egyes biomolekulák izolálása kulcsfontosságú a biológiai szerepük tisztázásához. Az affinitás kromatográfia egyszerűsége, reprodukálhatósága


Nagyfelbontású magassági szélklimatológiai információk dinamikai elıállítása

Nagyfelbontású magassági szélklimatológiai információk dinamikai elıállítása Nagyfelbontású magassági szélklimatológiai információk dinamikai elıállítása Szépszó Gabriella Országos Meteorológiai Szolgálat Éghajlati Osztály, Klímamodellezı Csoport Együttmőködési lehetıségek a hidrodinamikai



MŰSZAKKIOSZTÁSI PROBLÉMÁK A KÖZÖSSÉGI KÖZLEKEDÉSBEN infokommunikációs technológiák MŰSZAKKIOSZTÁSI PROBLÉMÁK A KÖZÖSSÉGI KÖZLEKEDÉSBEN Készítette: Árgilán Viktor, Dr. Balogh János, Dr. Békési József, Dávid Balázs, Hajdu László, Dr. Galambos Gábor, Dr. Krész


Ábragyűjtemény levelező hallgatók számára

Ábragyűjtemény levelező hallgatók számára Ábragyűjtemény levelező hallgatók számára Ez a bemutató a tanszéki Fizika jegyzet kiegészítése Mechanika I. félév 1 Stabilitás Az úszás stabilitása indifferens a stabil, b labilis S súlypont Sf a kiszorított


Modellek kalibrációja és a paraméterérzékenységi vizsgálat Kovács Balázs & Szanyi János

Modellek kalibrációja és a paraméterérzékenységi vizsgálat Kovács Balázs & Szanyi János Modellezés és kalibráció Modellek kalibrációja és a paraméterérzékenységi vizsgálat Kovács Balázs & Szanyi János Kovács Szanyi, 4-6 A kalibráció ( bearányosítás, jaj!) A kalibráció során a ismert valós


Szívókönyökök veszteségeinek és sebességprofiljainak vizsgálata CFD szimuláció segítségével

Szívókönyökök veszteségeinek és sebességprofiljainak vizsgálata CFD szimuláció segítségével GANZ ENGINEERING ÉS ENERGETIKAI GÉPGYÁRTÓ KFT. Szívókönyökök veszteségeinek és sebességprofiljainak vizsgálata CFD szimuláció segítségével Készítette: Bogár Péter Háznagy Gergely Egyed Csaba Zombor Csaba


Atomok. szilárd. elsődleges kölcsönhatás. kovalens ionos fémes. gázok, folyadékok, szilárd anyagok. ionos fémek vegyületek ötvözetek

Atomok. szilárd. elsődleges kölcsönhatás. kovalens ionos fémes. gázok, folyadékok, szilárd anyagok. ionos fémek vegyületek ötvözetek Atomok elsődleges kölcsönhatás kovalens ionos fémes véges számú atom térhálós szerkezet 3D ionos fémek vegyületek ötvözetek molekulák atomrácsos vegyületek szilárd gázok, folyadékok, szilárd anyagok Gázok


Feladatok. Tervek alapján látvány terv készítése. Irodai munka Test modellezés. Létező objektum számítógépes modelljének elkészítése

Feladatok. Tervek alapján látvány terv készítése. Irodai munka Test modellezés. Létező objektum számítógépes modelljének elkészítése Virtuális valóság Feladatok Tervek alapján látvány terv készítése Irodai munka Test modellezés Létező objektum számítógépes modelljének elkészítése Geodéziai mérések Fotogrammetriai feldolgozás Egyszerű


Thomson-modell (puding-modell)

Thomson-modell (puding-modell) Atommodellek Thomson-modell (puding-modell) A XX. század elejére világossá vált, hogy az atomban található elektronok ugyanazok, mint a katódsugárzás részecskéi. Magyarázatra várt azonban, hogy mi tartja


Számítógépes Grafika SZIE YMÉK

Számítógépes Grafika SZIE YMÉK Számítógépes Grafika SZIE YMÉK Analóg - digitális Analóg: a jel értelmezési tartománya (idő), és az értékkészletes is folytonos (pl. hang, fény) Diszkrét idejű: az értelmezési tartomány diszkrét (pl. a


2008 IV. 22. Internetes alkalmazások forgalmának mérése és osztályozása. Április 22.

2008 IV. 22. Internetes alkalmazások forgalmának mérése és osztályozása. Április 22. 2008 IV. 22. Internetes alkalmazások forgalmának mérése és osztályozása Az óra rövid vázlata Nemzetközi együttműködések áttekintése A CAIDA céljai A CAIDA főbb kutatási irányai 2007-2010 között Internet


A gáz halmazállapot. A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011

A gáz halmazállapot. A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 A gáz halmazállapot A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 0 Halmazállapotok, állapotjelzők Az anyagi rendszerek a részecskék közötti kölcsönhatásoktól és az állapotjelzőktől függően


A felhőről általában. Kacsuk Péter MTA SZTAKI

A felhőről általában. Kacsuk Péter MTA SZTAKI A felhőről általában Kacsuk Péter MTA SZTAKI Miért fontos a felhő? (I) Problémák, ha az infrastruktúra még nem létezik Az ötletek megvalósításához szükséges idő Kutatás a felhők előtt 1. Van egy jó ötlet


Atomok és molekulák elektronszerkezete

Atomok és molekulák elektronszerkezete Atomok és molekulák elektronszerkezete Szabad atomok és molekulák Schrödinger egyenlete Tekintsünk egy kvantummechanikai rendszert amely N n magból és N e elektronból áll. Koordinátáikat jelölje rendre


MATLAB. 6. gyakorlat. Integrálás folytatás, gyakorlás

MATLAB. 6. gyakorlat. Integrálás folytatás, gyakorlás MATLAB 6. gyakorlat Integrálás folytatás, gyakorlás Menetrend Kis ZH Példák integrálásra Kérdések, gyakorlás pdf Kis ZH Numerikus integrálás (ismétlés) A deriváláshoz hasonlóan lehet vektorértékek és megadott


Adatgyőjtés, mérési alapok, a környezetgazdálkodás fontosabb mőszerei

Adatgyőjtés, mérési alapok, a környezetgazdálkodás fontosabb mőszerei GazdálkodásimodulGazdaságtudományismeretekI.Közgazdaságtan KÖRNYEZETGAZDÁLKODÁSIMÉRNÖKIMScTERMÉSZETVÉDELMIMÉRNÖKIMSc Tudományos kutatásmódszertani, elemzési és közlési ismeretek modul Adatgyőjtés, mérési


Egyszerű programozási tételek

Egyszerű programozási tételek Egyszerű programozási tételek 2. előadás Sergyán Szabolcs Óbudai Egyetem Neumann János Informatikai Kar 2011. szeptember 15. Sergyán (OE NIK) AAO 02 2011. szeptember 15.


A fordítóprogramok szerkezete. Kódoptimalizálás. A kódoptimalizálás célja. A szintézis menete valójában. Kódoptimalizálási lépések osztályozása

A fordítóprogramok szerkezete. Kódoptimalizálás. A kódoptimalizálás célja. A szintézis menete valójában. Kódoptimalizálási lépések osztályozása A fordítóprogramok szerkezete Forrásprogram Forrás-kezelő (source handler) Kódoptimalizálás Fordítóprogramok előadás (A,C,T szakirány) Lexikális elemző (scanner) Szintaktikus elemző (parser) Szemantikus



Koós Dorián 9.B INFORMATIKA 9.B INFORMATIKA Számítástechnika rövid története. Az elektronikus számítógép kifejlesztése. A Neumann-elv. Információ és adat. A jel. A jelek fajtái (analóg- és digitális jel). Jelhalmazok adatmennyisége.


Adatszerkezetek 1. előadás

Adatszerkezetek 1. előadás Adatszerkezetek 1. előadás Irodalom: Lipschutz: Adatszerkezetek Morvay, Sebők: Számítógépes adatkezelés Cormen, Leiserson, Rives, Stein: Új algoritmusok


R R C X C X R R X + C H R CH CH R H + BH 2 + Eliminációs reakciók

R R C X C X R R X + C H R CH CH R H + BH 2 + Eliminációs reakciók Eliminációs reakciók Amennyiben egy szénatomhoz távozó csoport kapcsolódik és ugyanazon a szénatomon egy (az ábrákon vel jelölt) bázis által protonként leszakítható hidrogén is található, a nukleofil szubsztitúció


egy szisztolikus példa

egy szisztolikus példa Automatikus párhuzamosítás egy szisztolikus példa Áttekintés Bevezetés Példa konkrét szisztolikus algoritmus Automatikus párhuzamosítási módszer ötlet Áttekintés Bevezetés Példa konkrét szisztolikus algoritmus


Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T

Tartalmi követelmények kémia tantárgyból az érettségin K Ö Z É P S Z I N T 1. Általános kémia Atomok és a belőlük származtatható ionok Molekulák és összetett ionok Halmazok A kémiai reakciók A kémiai reakciók jelölése Termokémia Reakciókinetika Kémiai egyensúly Reakciótípusok


32. A Knuth-Morris-Pratt algoritmus

32. A Knuth-Morris-Pratt algoritmus 32. A Knuth-Morris-Pratt algoritmus A nyers erőt használó egyszerű mintaillesztés műveletigénye legrosszabb esetben m*n-es volt. A Knuth-Morris-Pratt algoritmus (KMP-vel rövidítjük) egyike azon mintaillesztő


Kutatási eredményeim a 2014 február 1- augusztus 31. a Varga József Alapítvány Pungor Ernő doktorjelölti ösztöndíjas időszak során

Kutatási eredményeim a 2014 február 1- augusztus 31. a Varga József Alapítvány Pungor Ernő doktorjelölti ösztöndíjas időszak során Kutatási eredményeim a 2014 február 1- augusztus 31. a Varga József Alapítvány Pungor Ernő doktorjelölti ösztöndíjas időszak során 1. projekt Kvaterner ammónium ligandot használó enzimek ligand kötőhelyének


ITIL alapú IT környezet kialakítás és IT szolgáltatás menedzsment megvalósítás az FHB-ban

ITIL alapú IT környezet kialakítás és IT szolgáltatás menedzsment megvalósítás az FHB-ban IBM Global Technology Services ITIL alapú IT környezet kialakítás és IT szolgáltatás menedzsment megvalósítás az FHB-ban ITSMF Magyarország 3. szemináriuma Tild Attila, ISM IBM Magyarországi Kft. 2006


Vektorgeometria (2) First Prev Next Last Go Back Full Screen Close Quit

Vektorgeometria (2) First Prev Next Last Go Back Full Screen Close Quit Vektorgeometria (2) First Prev Next Last Go Back Full Screen Close Quit 1. Tekintsünk a térben egy P (p 1, p 2, p 3 ) pontot és egy v = (v 1, v 2, v 3 ) = 0 vektort. Ekkor pontosan egy egyenes létezik,


Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze

Röntgen sugárzás. Wilhelm Röntgen. Röntgen feleségének keze Röntgendiffrakció Kardos Roland 2010.03.08. Előadás vázlata Röntgen sugárzás Interferencia Huygens teória Diffrakció Diffrakciós eljárások Alkalmazás Röntgen sugárzás 1895 röntgen sugárzás felfedezés (1901


A térképen ábrázolt vonal: - sík felület egyenese? - sík felület görbéje? - görbült felület egyenese ( geodetikus )? - görbült felület görbéje?

A térképen ábrázolt vonal: - sík felület egyenese? - sík felület görbéje? - görbült felület egyenese ( geodetikus )? - görbült felület görbéje? Előzetes megjegyzés: 1. Az időt nyugodtan mérhetjük méterben. ct [s ] = t [m ] A film kétórás volt. = A film 2.16 milliárd kilométernyi ideig tartott. 2. A tömeget is nyugodtan mérhetjük méterben! GM [kg]


Tárgymutató. dinamika, 5 dinamikai rendszer, 4 végtelen sok állapotú, dinamikai törvény, 5 dinamikai törvények, 12 divergencia,

Tárgymutató. dinamika, 5 dinamikai rendszer, 4 végtelen sok állapotú, dinamikai törvény, 5 dinamikai törvények, 12 divergencia, Tárgymutató állapottér, 3 10, 107 általánosított impulzusok, 143 147 általánosított koordináták, 143 147 áramlás, 194 197 Arisztotelész mozgástörvényei, 71 77 bázisvektorok, 30 centrifugális erő, 142 ciklikus


Beszélgetés a szerves kémia eméleti alapjairól IV.

Beszélgetés a szerves kémia eméleti alapjairól IV. Beszélgetés a szerves kémia eméleti alapjairól IV. Az alkének elektrofil addiciós reakciói Az alkénekben levő kettős kötés pi-elekronrendszerének jellegzetes térbeli orientáltsága kifejezetten nukleofil


Algoritmusok Tervezése. 6. Előadás Algoritmusok 101 Dr. Bécsi Tamás

Algoritmusok Tervezése. 6. Előadás Algoritmusok 101 Dr. Bécsi Tamás Algoritmusok Tervezése 6. Előadás Algoritmusok 101 Dr. Bécsi Tamás Mi az algoritmus? Lépések sorozata egy feladat elvégzéséhez (legáltalánosabban) Informálisan algoritmusnak nevezünk bármilyen jól definiált


Navigáci. stervezés. Algoritmusok és alkalmazásaik. Osváth Róbert Sorbán Sámuel

Navigáci. stervezés. Algoritmusok és alkalmazásaik. Osváth Róbert Sorbán Sámuel Navigáci ció és s mozgástervez stervezés Algoritmusok és alkalmazásaik Osváth Róbert Sorbán Sámuel Feladat Adottak: pálya (C), játékos, játékos ismerethalmaza, kezdőpont, célpont. Pálya szerkezete: akadályokkal


Robotika. Kinematika. Magyar Attila

Robotika. Kinematika. Magyar Attila Robotika Kinematika Magyar Attila Miről lesz szó? Bevezetés Merev test pozíciója és orientációja Rotáció Euler szögek Homogén transzformációk Direkt kinematika Nyílt kinematikai lánc


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


Információ megjelenítés Történet és példák. Dr. Iványi Péter

Információ megjelenítés Történet és példák. Dr. Iványi Péter Információ megjelenítés Történet és példák Dr. Iványi Péter Charles Minard (1781-1870) Francia mérnök Napóleon 1812-es oroszországi hadjárata William Playfair (1759-1823) The Commercial and Political Atlas,


A végeselem módszer alapjai. 2. Alapvető elemtípusok

A végeselem módszer alapjai. 2. Alapvető elemtípusok A végeselem módszer alapjai Előadás jegyzet Dr. Goda Tibor 2. Alapvető elemtípusok - A 3D-s szerkezeteket vagy szerkezeti elemeket gyakran egyszerűsített formában modellezzük rúd, gerenda, 2D-s elemek,


Antennatervező szoftverek. Ludvig Ottó - HA5OT

Antennatervező szoftverek. Ludvig Ottó - HA5OT Antennatervező szoftverek Ludvig Ottó - HA5OT Miről lesz szó? Megismerkedünk a számítógépes antenna modellezés alapjaival, és történetével Gyakorlati példákon keresztül elsajátítjuk az alapvető fogásokat



API-MÁGIA MILLIÓ SORNYI ADAT ÚJRARENDEZÉSE. Előadó: Jaksa Zsombor, API-MÁGIA MILLIÓ SORNYI ADAT ÚJRARENDEZÉSE Előadó: Jaksa Zsombor, MIRŐL FOG SZÓLNI AZ ELŐADÁS? Hogyan működik a Adatok gyűjtése, stratégiák# Ha marad időm még mesélek HOGYAN MŰKÖDIK


TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK


Feladatok a Gazdasági matematika II. tárgy gyakorlataihoz

Feladatok a Gazdasági matematika II. tárgy gyakorlataihoz Debreceni Egyetem Közgazdaságtudományi Kar Feladatok a Gazdasági matematika II tárgy gyakorlataihoz a megoldásra ajánlott feladatokat jelöli e feladatokat a félév végére megoldottnak tekintjük a nehezebb


1. Generátorrendszer. Házi feladat (fizikából tudjuk) Ha v és w nem párhuzamos síkvektorok, akkor generátorrendszert alkotnak a sík vektorainak

1. Generátorrendszer. Házi feladat (fizikából tudjuk) Ha v és w nem párhuzamos síkvektorok, akkor generátorrendszert alkotnak a sík vektorainak 1. Generátorrendszer Generátorrendszer. Tétel (Freud, 4.3.4. Tétel) Legyen V vektortér a T test fölött és v 1,v 2,...,v m V. Ekkor a λ 1 v 1 + λ 2 v 2 +... + λ m v m alakú vektorok, ahol λ 1,λ 2,...,λ
