7. Fehérjeszekvenciák és térszerkezetek analízise.

Save this PDF as:

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "7. Fehérjeszekvenciák és térszerkezetek analízise."


1 7. Fehérjeszekvenciák és térszerkezetek analízise. 1. Egyszerû elemzések 2. Térszerkezet predikció 2.1. A probléma bonyolultsága 2.2. A predikció szintjei D predikciók (másodlagos szerkezet, hozzáférhetõség, transzmembrán hélixek 3. Térszerkezetek elemzése: 3.1. Minõségellenõrzés 3.2. Másodlagos szerkezet 3.3. Szerkezeti motívumok 3.4. Kölcsönhatás ligandumokkal 3.5. Töltésviszonyok 3.6. Felszínek, üregek Egyszerû elemzések (lásd Expasy Tools) Fehérjeazonosítás AACompIdent: fehérje azonosítása aminosav összetétel alapján. Megadható még az izoelektromos pont (pi) és a molekulatömeg (Mw). Eredmény: rangsorolt lista a SWISSPROT ban lévõ, a megadott adatokhoz közeli paraméterekkel rendelkezõ fehérjékrõl. Távoli homológiák detektálhatók ezen a módon! PROPSEARCH: A megadott szekvenciából (csak az aminosav összetételbõl) 144 tulajdonságot számít ki (pl. nagy és kis oldalláncok részaránya, átlagos hidrofobicitás, átlagos töltés, bizonyos dipeptidek gyakorisága, stb.) Ezek alapján keres hasonlót a szekvenciaadatbázisokban. Távoli homológiák detektálhatóak vele! Fehérjeazonosítás tömegspektrometriai eredmények alapján Tömegspektrometria: valamilyen specifikus proteázzal (pl. tripszin) való emésztés után megadja a kapott peptidek pontos molekulatömegét. Ennek alapján a fehérje azonosítható. Leggyakrabban használt módszer: MALDI (Matrix Assisted Laser Desorption/Ionisation Mass Spectrometry) A fehérjét (annak fragmentumait) UV elnyelõ anyagba ágyazzák (mátrix), ezt a réteget UV lézerrel lövik, mire a molekulák ionizálódnak és leválnak a mátrixról. Elektromos térben felgyorsulnak, detektor méri a becsapódást. A becsapódásig eltelt idõbõl számítható a tömeg. Spektrum: 1

2 MOWSE: megadva az emésztéshez használt proteázt és a peptidtömegeket, rangsorolt listát ad az OWL adatbázisban lévõ, a megadott adatoknak megfelelõ fehérjékrõl Fizikai tulajdonságok a szekvenciából ProtParam: a szekvenciából egy sor mennyiséget számít ki (Mw, pi, aminosav és atomösszetétel, extinkciós koefficiens, stb.) PeptideMass: a megadott szekvencia proteolitikus emésztési fragmentumainak tömegét számítja ki SAPS (Statistical Analysis of Protein Sequences): rengeteg fizikai és kémiai információt számít a szekvenciából (aminosav összetétel, töltéseloszlás, pozitív és negatív töltésû klaszterek, mintázatok, hidrofób szegmensek, repetitív régiók, periodicitás, stb.) Térszerkezet predikció A probléma bonyolultsága Általánosságban: találjuk meg egy tetszõleges szekvencia azon konformációját, amely a szabadentalpia globális minimumát adja. Egyszerû modellekben kimutatható: a feladat ún. NP nehéz, vagyis a megoldásához szükséges idõ a (fehérje)mérettel nempolinomiális függvény szerint (hanem annál gyorsabban) növekszik. (Vagyis bizonyos mérethatár fölött nem megoldható.) Gyakorlatban: a valódi fehérjék szekvenciái nagyon specifikusak (evolúció során kiválogatódtak); a predikcióhoz felhasználhatjuk a már ismert térszerkezeteket mint tudásbázist A gyakorlatban tehát a probléma kezelhetõ. A predikció szintjei Jósolhatóak a fehérjeszerkezet egy, két, ill. háromdimenziós aspektusai: (1D, 2D és 3D információ. A 2D a kontaktustérkép.) 1D: aminosavakhoz köthetõ tulajdonságok, melyek 1D stringként írhatóak fel. Pl.: szekvencia, másodlagos szerkezet, oldószer általi hozzáférhetõség, hidrofobicitás 2D: aminosavpárok közötti távolságok, kontaktusok 3D: az összes atomi koordináta 2

3 1D predikciók Másodlagos szerkezet jóslása a szekvenciából A fontosabb módszerek az Expasy Tools oldalról elérhetõek. Módszerek (rengeteg van, ez csak néhány példa): 1. generációs 2. generációs 3. generációs Konszenzus Módszer Mûködés elve Kb. pontosság (%) Chou Fasman (CF) Garnier Osguthorpe Robson (GOR I, GOR II) Az egyes aminosavtípusok elõfordulásának valószínûsége a különbözõ másodlagos szerkezeti elemekben Lim 57 Nagano Statisztikai adatok 61 GOR III (aminosavpárok, ill. triplettek) 62 Ptitsyn Finkelstein Fizikai kémiai tul. 61 Qian Sejnowski Neuronhálózat 60 GOR IV 63 Szegmensstatisztika Schneider 63 NSSP 70 Többszörös összerendezések, LPAG neuronhálózat 68 PHD 73 JPRED SOPMA CNRS Több más módszer alapján konszenzus és 2. generációs módszerek: az egyes aminosavaknak a különbözõ másodlagos szerkezetekben való elõfordulásának gyakoriságai alapján dolgoznak. Pontosság <70%, béta szerkezetre csak 28 48%, túl rövid hélixek és béta szálak Chou Fasman: Alfa hélixet indít ott, ahol 6 egymás melletti aminosav közül 4 nek 1,03 a hélixben levési valószínûsége, béta szálat ott, ahol 5 egymás melletti aminosav közül 3 nak legalább 1,0 a bétában levési valószínûsége. Ezután a hélixeket és béta szálakat kiterjeszti mindkét irányba addig, amíg 4 egymás melletti aminosav átlagos hélix, ill. béta képzési valószínûsége 1,0 alá nem esik. Béta kanyar jóslása hasonló módon. GOR (Garnier Osguthorpe Robson): 17 aminosav szélességû ablakban vizsgálja az aminosavak elõfordulását, ezek alapján jósolja az ablak középsõ pozíciójában lévõ aminosavhoz tartozó másodlagos szerkezetet 3. generációs módszerek: a vizsgált szekvenciákhoz hasonlóakat keresnek és ezekbõl többszörös összerendezést készítenek, majd a többszörös összerendezésekben rejlõ információt használják fel. A többszörös összerendezések információt tartalmaznak az együtt mutálódó aminosavakról (korrelált mutációk), ezek többnyire a térszerkezetben egymáshoz közel vannak, tehát a többszörös összerendezés információt tartalmaz a fehérje harmadlagos szerkezetérõl, ily módon segíti a másodlagos szerkezet jóslását. Konszenzusos módszerek: több más módszert (2. és 3. generációs módszereket) alkalmaznak, az eredmények konszenzusát veszik. Pl. JPRED: Példa 3

4 PHD módszer (ma a legjobb, akár 77% pontosság) [Burkhard Rost] 1. adatbázisból kikeressük a rokon szekvenciákat (BLAST program) 2. Elkészítjük ezek többszörös összerendezését (MaxHom program) 3. Az összerendezés szûrése, jó homológok megtartása, újból összerendezés 4. A végsõ összerendezés alapján mindegyik pozícióra elkészítjük az elõforduló aminosavcserék profilját 5. Ez szolgál bemenetként a neuronhálózatnak Bár a PHD módszer a legjobbnak látszik, mégsem mindig az, ezért helyes, ha konszenzus módszert alkalmazunk, ill. több módszert együtt. Oldószer általi hozzáférhetõség predikciója Felszíni vagy eltemetett az oldallánc Kezdetleges predikció: az oldallánc hidrofobicitása alapján > gyenge eredmény Jobb predikció: evolúciós információ bevitele többszörös összerendezések útján > 75% pontosságú jóslás (PHDacc) Transzmembrán hélixek predikciója Transzmembrán fehérjék topológiája Három állapot: bent, kint, membránban Hidrofobicitási plot: valamilyen hidrofobicitási skála (itt: Kyte Doolittle) alapján, simítással. Pl. egy transzmembrán fehérjére a ProtScale programmal: 4

5 Jó, de durva becslést ad a transzmembrán régiókra. Kifinomultabb módszerek; a többszörös összerendezést használók itt is eredményesek (>95% pontosság) Pl. TMPRED, HMMTOP. Legpontosabbnak tûnik: rejtett Markov modell (HMMTOP by Tusnády Gábor): közel 100%. De: kevés az ismert szerkezet, így kevéssé ismert a megbízhatóság. 2D predikciók Oldallánc kontaktusok predikciója Az összes kontaktusból elvben felépíthetõ a 3D szerkezet Próbálkoztak kontaktusokat jósolni a következõk alapján: szekvenciában távoli aminosavak együtt elõforduló (korrelált) mutációi statisztika átlagtér potenciálok neuronhálózatok Az eddigi eredmények nem kielégítõek Fehérjeszerkezetek elemzése Célja: a mûködés mechanizmusának részletes megértése, az egyes szerkezeti motívumok felismerése, jelentõségük feltárása, stb. Minõségellenõrzés PDB ben lévõ szerkezetek nagy része tökéletlen, hibákat tartalmaz. A modellezéssel nyert szerkezetek még inkább. Minõségellenõrzés elvei: Kémiai felépítés: megvan e minden atom, nem szakadt e a lánc, stb. Sztereokémia: Kötéshosszak, kötésszögek, torziós szögek megfelelnek e az elvárható (a jó szerkezetek átlagából számított) értékeknek? Nincsenek e túl közel esõ atomok? Fehérjetulajdonságok: Ramachandran térképen a fi és pszi szögek eloszlása (nincs e valami a tiltott zónában, stb.); oldalláncok jó környezetben vannak e, megfelelõen szoros e a hidrofób mag pakoltsága, stb. Többféle program: PROCHECK, WHAT_CHECK PROCHECK kimenetek pl.: 5

6 Ramachandran plot Oldallánc paraméterek 6

7 Geometriai torzulások Másodlagos szerkezet A meglévõ atomi térszerkezet alapján hogyan definiáljuk a benne lévõ másodlagos szerkezeti elemeket? Másodlagos szerk. definiálható a fi, pszi szögek alapján is, de ez nem megbízható Bevált: a hidrogénkötési mintázat alapján (pl. hélixek: i >i+4 H kötések, stb.) Standard módszer: DSSP program (és adatbázis). Példa Kódok: H: Hélix, E: Béta szál, B: izolált H kötés, S: görbület, G: 3 10 hélix, stb. 7

8 Szerkezeti motívumok PROMOTIF program és adatbázis. Fõlánc H kötései Hélixek 8

9 Béta turnök Kölcsönhatás ligandumokkal Vizualizálható: LIGPLOT H kötéseket és hidrofób felszíneket mutatja 9

10 Töltésviszonyok Poisson Boltzmann módszerrel számítható az elektrosztatikus potenciál a fehérje felszínén és környezetében: DELPHI program. Megjelenítés: GRASP program (nem ingyenesek). acetilkolin észteráz Szubsztrát közelében a fókuszáló hatás, stb. leírható. Felszínek, üregek A felszín meghatározása: Vízmolekula (1,4 angström sugarú gömbbel modellezve) végiggördítése a felszínen Hozzáférhetõ felszín: a vízmolekula közepe által leírt felszín Molekuláris felszín: a vízmolekula felülete által leírt felszín 10

11 Standard program: Molecular Surface Package (Connolly) (nem ingyenes; számos ingyenes program van, amelyek rosszabbak) Az apoláros, pozitív, és negatív töltésû felszínrészek más más színnel jelölve Kék színnel jelöltük a fehérje belsejében lévõ üregeket. 11

Bioinformatika 2 5.. előad

Bioinformatika 2 5.. előad 5.. előad adás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 03. 21. Fehérje térszerkezet t megjelenítése A fehérjék meglehetősen összetett


A fehérjék térszerkezetének jóslása

A fehérjék térszerkezetének jóslása A fehérjék térszerkezetének jóslása 1. A probléma bonyolultsága 2. A predikció szintjei 3. 1D predikciók (másodlagos szerkezet, hozzáférhetõség, transzmembrán hélixek 4. 2D predikciók (oldallánc kontaktusok,


Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis Szerkezet Protein Data Bank (PDB) http://www.rcsb.org/pdb ~ 35 701 szerkezet közepes felbontás 1552 szerkezet d 1.5 Å 160 szerkezet d 1.0 Å 10 szerkezet d 0.8 Å (atomi felbontás) E globális minimum? funkció


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni


8. A fehérjék térszerkezetének jóslása

8. A fehérjék térszerkezetének jóslása 8. A fehérjék térszerkezetének jóslása A probléma bonyolultsága Általánosságban: találjuk meg egy tetszõleges szekvencia azon konformációját, amely a szabadentalpia globális minimumát adja. Egyszerû modellekben


Bioinformatika előad

Bioinformatika előad 7.. előad adás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 04. 03. Térszerkezet előrejelz rejelzés s főf módszerei Homológia modellezés


A tárgy címe: Bioinformatika

A tárgy címe: Bioinformatika A tárgy címe: Bioinformatika Kötelezően választható tárgy IV. és V. évfolyamos biológus hallgatók számára; heti 2+3 óra Előkövetelmény: Biokémia főkollégium; genetika főkollégium; alapszintű számítógépes


Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók

Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások. Elektrosztatikus számítások Definíciók Jelentősége szubsztrát kötődés szolvatáció ionizációs állapotok (pka) mechanizmus katalízis ioncsatornák szimulációk (szerkezet) all-atom dipolar fluid dipolar lattice continuum Definíciók töltéseloszlás


A fehérjék térszerkezetének jóslása (Szilágyi András, MTA Enzimológiai Intézete)

A fehérjék térszerkezetének jóslása (Szilágyi András, MTA Enzimológiai Intézete) A fehérjék térszerkezetének jóslása (Szilágyi András, MTA Enzimológiai Intézete) A probléma bonyolultsága Általánosságban: találjuk meg egy tetszőleges szekvencia azon konformációját, amely a szabadentalpia


Fehérjeszerkezet, és tekeredés

Fehérjeszerkezet, és tekeredés Fehérjeszerkezet, és tekeredés Futó Kinga 2013.10.08. Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983


2. Ismert térszerkezetű transzmembrán fehérjék adatbázisa: a PDBTM adatbázis. 3. A transzmembrán fehérje topológiai adatbázis, a TOPDB szerver

2. Ismert térszerkezetű transzmembrán fehérjék adatbázisa: a PDBTM adatbázis. 3. A transzmembrán fehérje topológiai adatbázis, a TOPDB szerver A 2005 és 2007 között megvalósított project célja transzmembrán fehérjék vizsgálata és az ehhez szükséges eljárások kifejlesztése volt. Ez utóbbi magába foglalta új adatbázisok és szerkezet becslő módszerek


Bakteriális identifikáció 16S rrns gén szekvencia alapján

Bakteriális identifikáció 16S rrns gén szekvencia alapján Bakteriális identifikáció 16S rrns gén szekvencia alapján MOHR ANITA SIPOS RITA, SZÁNTÓ-EGÉSZ RÉKA, MICSINAI ADRIENN 2100 Gödöllő, Szent-Györgyi Albert út 4. info@biomi.hu, www.biomi.hu TÖRZS AZONOSÍTÁS


Felhő használata mindennapi alkalmazások futtatására. Németh Zsolt MTA SZTAKI

Felhő használata mindennapi alkalmazások futtatására. Németh Zsolt MTA SZTAKI Felhő használata mindennapi alkalmazások futtatására Németh Zsolt MTA SZTAKI Legyőzni a maláriát 45 másodpercenként meghal egy gyerek maláriában Évente 216 millió ember fertőződik meg és 650000 meghal


A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.


A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék


TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK


A rácsmodell. Szabadenergia felületek.

A rácsmodell. Szabadenergia felületek. 1. A spinüveg modell 2. A rácsmodellek típusai 3. A rácsmodellek elõnyei és hátrányai 4. A rácsmodellek elemzése 5. Egyszerû rácsmodellek 6. Rácsmodellek natív állapotai 7. Oldalláncok 8. Rácsmodellek


Fehérjék rövid bevezetés

Fehérjék rövid bevezetés Receptorfehérj rjék szerkezetének felderítése Homológia modellezés Fehérjék rövid bevezetés makromolekulák számos biológiai funkció hordozói: enzimatikus katalízis, molekula transzport, immunválaszok,


Használati útmutató Az online példatárhoz

Használati útmutató Az online példatárhoz Használati útmutató Az online példatárhoz A Példatár egy többféle szűrési feltétellel és találati megjelenítéssel rendelkező online adatbázis: I. Keresés 1. Találati lista 2. Térképes megjelenítés 3. Alrendszerek


Fehérje-fehérje kölcsönhatások és kölcsönhatási hálózatok. Szilágyi András

Fehérje-fehérje kölcsönhatások és kölcsönhatási hálózatok. Szilágyi András Fehérje-fehérje kölcsönhatások és kölcsönhatási hálózatok Szilágyi András Vázlat Fehérje-fehérje kölcsönhatások Kölcsönhatási hálózatok Kísérleti módszerek Bioinformatikai vonatkozások adatbázisok szerkezetfüggetlen


Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék

Bio-nanorendszerek. Vonderviszt Ferenc. Pannon Egyetem Nanotechnológia Tanszék Bio-nanorendszerek Vonderviszt Ferenc Pannon Egyetem Nanotechnológia Tanszék Technológia: képesség az anyag szerkezetének, az anyagot felépítő részecskék elrendeződésének befolyásolására. A technológiai


Tusnády E. Gábor. Sztochasztikus modellek a fehérjekutatásban. Doktori (Ph.D.) értekezés. ELTE TTK Szerkezeti Biokémia Program

Tusnády E. Gábor. Sztochasztikus modellek a fehérjekutatásban. Doktori (Ph.D.) értekezés. ELTE TTK Szerkezeti Biokémia Program Tusnády E. Gábor Sztochasztikus modellek a fehérjekutatásban Doktori (Ph.D.) értekezés ELTE TTK Szerkezeti Biokémia Program Témavezető: Dr. Simon István Készült: a Magyar Tudományos kadémia Szegedi Biológiai


Adatelemzési eljárások az idegrendszer kutatásban Somogyvári Zoltán

Adatelemzési eljárások az idegrendszer kutatásban Somogyvári Zoltán Adatelemzési eljárások az idegrendszer kutatásban Somogyvári Zoltán MTA KFKI Részecske és Magfizikai Intézet, Biofizikai osztály Az egy adatsorra (idősorra) is alkalmazható módszerek Példa: Az epileptikus


Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,


Az anyagi rendszer fogalma, csoportosítása

Az anyagi rendszer fogalma, csoportosítása Az anyagi rendszer fogalma, csoportosítása A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 1 A rendszer fogalma A körülöttünk levő anyagi világot atomok, ionok, molekulák építik


Bioinformatika 2 10.el

Bioinformatika 2 10.el 10.el őadás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 04. 24. Genomikavs. proteomika A genomika módszereivel nem a tényleges fehérjéket


5/11/2015 TÖMEGSPEKTROMETRIA. Tömegspektrometria - áttekintés. Ionizáció és analizátor. Tömegspektrométer. Analizátor: KVADRUPOL

5/11/2015 TÖMEGSPEKTROMETRIA. Tömegspektrometria - áttekintés. Ionizáció és analizátor. Tömegspektrométer. Analizátor: KVADRUPOL PÉCSI TUDOMÁNYEGYETEM ÁLTALÁNOS ORVOSTUDOMÁNYI KAR www.aok.pte.hu TÖMEGSPEKTROMETRIA Tömegspektrometria - áttekintés VIZSGÁLHATÓ MINTA: töltéssel rendelkezik (folyékony biológiai minták, fehérjék, peptidek,


Enzimek. Enzimek! IUBMB: szisztematikus nevek. Enzimek jellemzése! acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás. szubsztrát-specificitás

Enzimek. Enzimek! IUBMB: szisztematikus nevek. Enzimek jellemzése! acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás. szubsztrát-specificitás Enzimek acetilkolin-észteráz! Enzimek! [s -1 ] enzim víz carbonic anhydrase 6x10 5 10-9 karbonikus anhidráz acetylcholine esterase 2x10 4 8x10-10 acetilkolin észteráz staphylococcal nuclease 10 2 2x10-14



A TÖMEGSPEKTROMETRIA ALAPJAI A TÖMEGSPEKTROMETRIA ALAPJAI web.inc.bme.hu/csonka/csg/oktat/tomegsp.doc alapján tömeg-töltés arány szerinti szétválasztás a legérzékenyebb módszerek közé tartozik (Nagyon kis anyagmennyiség kimutatására


Gyakorlati bioinformatika

Gyakorlati bioinformatika Gyakorlati bioinformatika Szekvenciaillesztés PhD kurzus 2. Szekvenciaillesztés Bagossi Péter Fajtái: - egyszer ill. többszörös illesztés - globális ill. lokális illesztés Alkalmazása: - adatbázisokban


Bioinformatika előadás

Bioinformatika előadás Bioinformatika 2 11. előadás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2016.11.28. Bioinformatics Szerkezeti genomika, proteomika, biológia


Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése

Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése Célkitűzés/témák Fehérje-ligandum kölcsönhatások és a kötődés termodinamikai jellemzése Ferenczy György Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biokémiai folyamatok - Ligandum-fehérje kötődés


Statisztika - bevezetés Méréselmélet PE MIK MI_BSc VI_BSc 1

Statisztika - bevezetés Méréselmélet PE MIK MI_BSc VI_BSc 1 Statisztika - bevezetés 00.04.05. Méréselmélet PE MIK MI_BSc VI_BSc Bevezetés Véletlen jelenség fogalma jelenséget okok bizonyos rendszere hozza létre ha mindegyik figyelembe vehető egyértelmű leírás általában


Nukleinsavak építőkövei

Nukleinsavak építőkövei ukleinsavak Szerkezeti hierarchia ukleinsavak építőkövei Pirimidin Purin Pirimidin Purin Timin (T) Adenin (A) Adenin (A) Citozin (C) Guanin (G) DS bázisai bázis Citozin (C) Guanin (G) RS bázisai bázis


Méréselmélet MI BSc 1

Méréselmélet MI BSc 1 Mérés és s modellezés 2008.02.15. 1 Méréselmélet - bevezetés a mérnöki problémamegoldás menete 1. A probléma kitűzése 2. A hipotézis felállítása 3. Kísérlettervezés 4. Megfigyelések elvégzése 5. Adatok



A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László A BIOLÓGIAI JELENSÉGEK FIZIKAI HÁTTERE Zimányi László Összefoglalás A négy alapvető fizikai kölcsönhatás közül az elektromágneses kölcsönhatásnak van fontos szerepe a biológiában. Atomi és molekuláris


Röntgendiffrakció, tömegspektrometria, infravörös spektrometria.

Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. A biomolekuláris szerkezet és dinamika vizsgálómódszerei: Röntgendiffrakció, tömegspektrometria, infravörös spektrometria. Smeller László A molekuláris szerkezet és dinamika vizsgáló módszereinek áttekintése


Erőterek. Erőterek. Erőterek. Erőterek. Erőterek. Erőterek. Probléma: fehérjéknél nagy dimenziók értelmetlen QM eredmények.

Erőterek. Erőterek. Erőterek. Erőterek. Erőterek. Erőterek. Probléma: fehérjéknél nagy dimenziók értelmetlen QM eredmények. fehérjéknél nagy dimenziók értelmetlen QM eredmények Megoldás: egyszerűsítés dimenzió-csökkentés Közelítések Born-Oppenheimer közelítés (Ψ mol = Ψ el Ψ mag ; E tot =E el +E mag ) az energia párkölcsönhatások


Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n. 2008. április 29.

Modern Fizika Labor. Fizika BSc. Értékelés: A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n. 2008. április 29. Modern Fizika Labor Fizika BSc A mérés dátuma: A mérés száma és címe: 13. mérés: Molekulamodellezés PC-n Értékelés: A beadás dátuma: 2008. május 6. A mérést végezte: 1/5 A mérés célja A mérés célja az


1. változat. 4. Jelöld meg azt az oxidot, melynek megfelelője a vas(iii)-hidroxid! A FeO; Б Fe 2 O 3 ; В OF 2 ; Г Fe 3 O 4.

1. változat. 4. Jelöld meg azt az oxidot, melynek megfelelője a vas(iii)-hidroxid! A FeO; Б Fe 2 O 3 ; В OF 2 ; Г Fe 3 O 4. 1. változat z 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Melyik sor fejezi be helyesen az állítást:


Részecske azonosítás kísérleti módszerei

Részecske azonosítás kísérleti módszerei Részecske azonosítás kísérleti módszerei Galgóczi Gábor Előadás vázlata A részecske azonosítás létjogosultsága Részecske azonosítás: Módszerek Detektorok ALICE-ból példa A részecskeazonosítás létjogosultsága


Modern műszeres analitika szeminárium Néhány egyszerű statisztikai teszt

Modern műszeres analitika szeminárium Néhány egyszerű statisztikai teszt Modern műszeres analitika szeminárium Néhány egyszerű statisztikai teszt Galbács Gábor KIUGRÓ ADATOK KISZŰRÉSE STATISZTIKAI TESZTEKKEL Dixon Q-tesztje Gyakori feladat az analitikai kémiában, hogy kiugrónak


Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések

Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Sillabusz orvosi kémia szemináriumokhoz 1. Kémiai kötések Pécsi Tudományegyetem Általános Orvostudományi Kar 2010-2011. 1 A vegyületekben az atomokat kémiai kötésnek nevezett erők tartják össze. Az elektronok


MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére

MedInProt Szinergia IV. program. Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére MedInProt Szinergia IV. program Szerkezetvizsgáló módszer a rendezetlen fehérjék szerkezetének és kölcsönhatásainak jellemzésére Tantos Ágnes MTA TTK Enzimológiai Intézet, Rendezetlen fehérje kutatócsoport


41. ábra A NaCl rács elemi cellája

41. ábra A NaCl rács elemi cellája 41. ábra A NaCl rács elemi cellája Mindkét rácsra jellemző, hogy egy tetszés szerint kiválasztott pozitív vagy negatív töltésű iont ellentétes töltésű ionok vesznek körül. Különbség a közvetlen szomszédok


Kémiai kötések. Kémiai kötések. A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011

Kémiai kötések. Kémiai kötések. A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 Kémiai kötések A bemutatót összeállította: Fogarasi József, Petrik Lajos SZKI, 2011 1 Cl + Na Az ionos kötés 1. Cl + - + Na Klór: 1s 2 2s 2 2p 6 3s 2 3p 5 Kloridion: 1s2 2s2 2p6 3s2 3p6 Nátrium: 1s 2 2s


5. Másodlagos adatbázisok

5. Másodlagos adatbázisok 5. Másodlagos adatbázisok 1. Alapfogalmak 2. Reguláris kifejezések, "aláírások" (PROSITE) 3. "Ujjlenyomatok" (PRINTS) 4. "Blokkok" (BLOCKS) 5. "Profilok": Prosite, Pfam 6. "Fuzzy" reguláris kifejezések:


Statisztika I. 8. előadás. Előadó: Dr. Ertsey Imre

Statisztika I. 8. előadás. Előadó: Dr. Ertsey Imre Statisztika I. 8. előadás Előadó: Dr. Ertsey Imre Minták alapján történő értékelések A statisztika foglalkozik. a tömegjelenségek vizsgálatával Bizonyos esetekben lehetetlen illetve célszerűtlen a teljes


Kolloidstabilitás. Berka Márta 2010/2011/II

Kolloidstabilitás. Berka Márta 2010/2011/II Kolloidstabilitás Berka Márta 2010/2011/II Kolloid stabilitáshoz taszítás kell. Sztérikus stabilizálás V R V S sztérikus stabilizálás: liofil kolloidok alkalmazása védőhatás adszorpció révén (természetes


FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino


Görbe- és felületmodellezés. Szplájnok Felületmodellezés

Görbe- és felületmodellezés. Szplájnok Felületmodellezés Görbe- és felületmodellezés Szplájnok Felületmodellezés Spline (szplájn) Spline: Szakaszosan, parametrikus polinomokkal leírt görbe A spline nevét arról a rugalmasan hajlítható vonalzóról kapta, melyet


Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén

Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Dr. Dallmann Klára A molekuláris biológia célja az élőlények és sejtek működésének molekuláris szintű


Biometria az orvosi gyakorlatban. Korrelációszámítás, regresszió

Biometria az orvosi gyakorlatban. Korrelációszámítás, regresszió SZDT-08 p. 1/31 Biometria az orvosi gyakorlatban Korrelációszámítás, regresszió Werner Ágnes Villamosmérnöki és Információs Rendszerek Tanszék e-mail: werner.agnes@virt.uni-pannon.hu Korrelációszámítás


Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Dr. Czeglédi Levente Dr. Béri Béla Kutatás-fejlesztés támogatása a megújuló energiaforrások és agrár


x = cos αx sin αy y = sin αx + cos αy 2. Mi a X/Y/Z tengely körüli forgatás transzformációs mátrixa 3D-ben?

x = cos αx sin αy y = sin αx + cos αy 2. Mi a X/Y/Z tengely körüli forgatás transzformációs mátrixa 3D-ben? . Mi az (x, y) koordinátákkal megadott pont elforgatás uténi két koordinátája, ha α szöggel forgatunk az origó körül? x = cos αx sin αy y = sin αx + cos αy 2. Mi a X/Y/Z tengely körüli forgatás transzformációs


Mérés és modellezés Méréstechnika VM, GM, MM 1

Mérés és modellezés Méréstechnika VM, GM, MM 1 Mérés és modellezés 2008.02.04. 1 Mérés és modellezés A mérnöki tevékenység alapeleme a mérés. A mérés célja valamely jelenség megismerése, vizsgálata. A mérés tervszerűen végzett tevékenység: azaz rögzíteni


Szimulációk egyszerősített fehérjemodellekkel. Szilágyi András

Szimulációk egyszerősített fehérjemodellekkel. Szilágyi András Szimulációk egyszerősített fehérjemodellekkel Szilágyi András Szimulációs módszerek alkalmazhatósági tartományai Egyszerősített modellek Három típusát mutatjuk be: Játék rácsmodellek Realisztikusabb rácsmodellek


Termék modell. Definíció:

Termék modell. Definíció: Definíció: Termék modell Összetett, többfunkciós, integrált modell (számítógépes reprezentáció) amely leír egy műszaki objektumot annak különböző életfázis szakaszaiban: tervezés, gyártás, szerelés, szervízelés,


Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására

Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására Szalma Katalin Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására Témavezető: Dr. Turai István, OSSKI Budapest, 2010. október 4. Az ionizáló sugárzás sejt kölcsönhatása Antone


Kötések kialakítása - oktett elmélet

Kötések kialakítása - oktett elmélet Kémiai kötések Az elemek és vegyületek halmazai az atomok kapcsolódásával - kémiai kötések kialakításával - jönnek létre szabad atomként csak a nemesgázatomok léteznek elsődleges kémiai kötések Kötések


A sztereoizoméria hatása peptidek térszerkezetére és bioaktivitására OTKA PD Szakmai zárójelentés. Dr. Leitgeb Balázs

A sztereoizoméria hatása peptidek térszerkezetére és bioaktivitására OTKA PD Szakmai zárójelentés. Dr. Leitgeb Balázs A sztereoizoméria hatása peptidek térszerkezetére és bioaktivitására OTKA PD 78554 Szakmai zárójelentés Dr. Leitgeb Balázs A projekt során azt tanulmányoztam, hogy a sztereoizoméria milyen hatásokat fejt


A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék


Lemezalkatrész modellezés. SolidEdge. alkatrészen

Lemezalkatrész modellezés. SolidEdge. alkatrészen A példa megnevezése: A példa száma: A példa szintje: Modellezõ rendszer: Kapcsolódó TÁMOP tananyag rész: A feladat rövid leírása: Lemezalkatrész modellezés SZIE-A5 alap közepes - haladó SolidEdge CAD 3D


Kémiai kötés Lewis elmélet

Kémiai kötés Lewis elmélet Kémiai kötés 10-1 Lewis elmélet 10-2 Kovalens kötés: bevezetés 10-3 Poláros kovalens kötés 10-4 Lewis szerkezetek 10-5 A molekulák alakja 10-6 Kötésrend, kötéstávolság 10-7 Kötésenergiák Általános Kémia,


Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői.

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői. Immunológia alapjai 3 4. előadás Az immunológiai felismerés molekuláris összetevői. Az antigén fogalma. Antitestek, T- és B- sejt receptorok: molekuláris szerkezet, funkciók, alcsoportok Az antigén meghatározása


Radon leányelemek depozíciója és tisztulása a légzőrendszerből

Radon leányelemek depozíciója és tisztulása a légzőrendszerből Radon leányelemek depozíciója és tisztulása a légzőrendszerből Füri Péter, Balásházy Imre, Kudela Gábor, Madas Balázs Gergely, Farkas Árpád, Jókay Ágnes, Czitrovszky Blanka Sugárvédelmi Továbbképző Tanfolyam


Új típusú döntési fa építés és annak alkalmazása többtényezős döntés területén

Új típusú döntési fa építés és annak alkalmazása többtényezős döntés területén Új típusú döntési fa építés és annak alkalmazása többtényezős döntés területén Dombi József Szegedi Tudományegyetem Bevezetés - ID3 (Iterative Dichotomiser 3) Az ID algoritmusok egy elemhalmaz felhasználásával


ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával www.chem.elte.hu/pr Kvíz az előző előadáshoz 1) Mikor kapott Paul Ehrlich orvosi Nobel-díjat? A) Idén. B) Pont 100 éve, 1908-ban. C) Nem


Rendezetlen fehérjék kölcsönhatásainak vizsgálata: elmélet, predikciók és alkalmazások

Rendezetlen fehérjék kölcsönhatásainak vizsgálata: elmélet, predikciók és alkalmazások Rendezetlen fehérjék kölcsönhatásainak vizsgálata: elmélet, predikciók és alkalmazások Doktori (PhD) értekezés tézisei Mészáros Bálint Témavezetők: Dr. Dosztányi Zsuzsanna, PhD és Prof. Simon István, PhD,





Tartalomjegyzék. Emlékeztetõ. Emlékeztetõ. Spektroszkópia. Fényelnyelés híg oldatokban A fény; Abszorpciós spektroszkópia

Tartalomjegyzék. Emlékeztetõ. Emlékeztetõ. Spektroszkópia. Fényelnyelés híg oldatokban A fény;  Abszorpciós spektroszkópia Tartalomjegyzék PÉCS TUDOMÁNYEGYETEM ÁLTALÁNOS ORVOSTUDOMÁNY KAR A fény; Abszorpciós spektroszkópia Elektromágneses hullám kölcsönhatása anyaggal; (Nyitrai Miklós; 2015 január 27.) Az abszorpció mérése;


Robotika. Kinematika. Magyar Attila

Robotika. Kinematika. Magyar Attila Robotika Kinematika Magyar Attila amagyar@almos.vein.hu Miről lesz szó? Bevezetés Merev test pozíciója és orientációja Rotáció Euler szögek Homogén transzformációk Direkt kinematika Nyílt kinematikai lánc


Általános Kémia, BMEVESAA101 Dr Csonka Gábor, egyetemi tanár. Az anyag Készítette: Dr. Csonka Gábor egyetemi tanár,

Általános Kémia, BMEVESAA101 Dr Csonka Gábor, egyetemi tanár. Az anyag Készítette: Dr. Csonka Gábor egyetemi tanár, Általános Kémia, BMEVESAA101 Dr Csonka Gábor, egyetemi tanár Az anyag Készítette: Dr. Csonka Gábor egyetemi tanár, csonkagi@gmail.com 1 Jegyzet Dr. Csonka Gábor http://web.inc.bme.hu/csonka/ Facebook,


Evolúcióelmélet és az evolúció mechanizmusai

Evolúcióelmélet és az evolúció mechanizmusai Evolúcióelmélet és az evolúció mechanizmusai Az élet Darwini szemlélete Melyek az evolúció bizonyítékai a világban? EVOLÚCIÓ: VÁLTOZATOSSÁG Mutáció Horizontális géntranszfer Genetikai rekombináció Rekombináció


Korszerű tömegspektrometria a. Szabó Pál MTA Kémiai Kutatóközpont

Korszerű tömegspektrometria a. Szabó Pál MTA Kémiai Kutatóközpont Korszerű tömegspektrometria a biokémi miában Szabó Pál MTA Kémiai Kutatóközpont Tematika Bevezetés: ionizációs technikák és analizátorok összehasonlítása a biomolekulák szemszögéből Mikromennyiségek mintaelőkészítése


(Solid modeling, Geometric modeling) Testmodell: egy létező vagy elképzelt objektum digitális reprezentációja.

(Solid modeling, Geometric modeling) Testmodell: egy létező vagy elképzelt objektum digitális reprezentációja. Testmodellezés Testmodellezés (Solid modeling, Geometric modeling) Testmodell: egy létező vagy elképzelt objektum digitális reprezentációja. A tervezés (modellezés) során megadjuk a objektum geometria



MOBIL TÉRKÉPEZŐ RENDSZER PROJEKT TAPASZTALATOK MOBIL TÉRKÉPEZŐ RENDSZER PROJEKT TAPASZTALATOK GISopen 2011 2011. március 16-18. Konasoft Project Tanácsadó Kft. Maros Olivér - projektvezető MIÉRT MOBIL TÉRKÉPEZÉS? A mobil térképezés egyetlen rendszerben


[Biomatematika 2] Orvosi biometria

[Biomatematika 2] Orvosi biometria [Biomatematika 2] Orvosi biometria 2016.02.29. A statisztika típusai Leíró jellegű statisztika: összegzi egy adathalmaz jellemzőit. A középértéket jelemzi (medián, módus, átlag) Az adatok változékonyságát


Kutatási eredményeim a 2014 február 1- augusztus 31. a Varga József Alapítvány Pungor Ernő doktorjelölti ösztöndíjas időszak során

Kutatási eredményeim a 2014 február 1- augusztus 31. a Varga József Alapítvány Pungor Ernő doktorjelölti ösztöndíjas időszak során Kutatási eredményeim a 2014 február 1- augusztus 31. a Varga József Alapítvány Pungor Ernő doktorjelölti ösztöndíjas időszak során 1. projekt Kvaterner ammónium ligandot használó enzimek ligand kötőhelyének


MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben

MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben Modul cím: MEDICINÁLIS ALAPISMERETEK AZ ÉLŐ SZERVEZETEK KÉMIAI ÉPÍTŐKÖVEI A LIPIDEK 1. kulcsszó cím: A lipidek szerepe az emberi szervezetben Tartalék energiaforrás, membránstruktúra alkotása, mechanikai


Molekuláris motorok működése

Molekuláris motorok működése Biológiai molekuláris motorok tulajdonságai Molekuláris motorok működése Osváth Szabolcs Semmelweis Egyetem - anyaguk lágy (biopolimerek) - nem kovalens kölcsönhatások vezérlik a működést - nincsenek sima


Digitális hőmérő Modell DM-300

Digitális hőmérő Modell DM-300 Digitális hőmérő Modell DM-300 Használati útmutató Ennek a használati útmutatónak a másolásához, terjesztéséhez, a Transfer Multisort Elektronik cég írásbeli hozzájárulása szükséges. Bevezetés Ez a készülék


STATISZTIKA ELŐADÁS ÁTTEKINTÉSE. Mi a modell? Matematikai statisztika. 300 dobás. sűrűségfüggvénye. Egyenletes eloszlás

STATISZTIKA ELŐADÁS ÁTTEKINTÉSE. Mi a modell? Matematikai statisztika. 300 dobás. sűrűségfüggvénye. Egyenletes eloszlás ELŐADÁS ÁTTEKINTÉSE STATISZTIKA 7. Előadás Egyenletes eloszlás Binomiális eloszlás Normális eloszlás Standard normális eloszlás Normális eloszlás mint modell /56 Matematikai statisztika Reprezentatív mintavétel


Mérés és modellezés 1

Mérés és modellezés 1 Mérés és modellezés 1 Mérés és modellezés A mérnöki tevékenység alapeleme a mérés. A mérés célja valamely jelenség megismerése, vizsgálata. A mérés tervszerűen végzett tevékenység: azaz rögzíteni kell


Gáspári Zoltán. Élő molekulák az élet molekulái

Gáspári Zoltán. Élő molekulák az élet molekulái Gáspári Zoltán Élő molekulák az élet molekulái Invokáció Kajtár Márton 1929-1991 www.eotvoskiado.hu Élő és élettelen? Élő és élettelen: a kemoton Élő kémiai rendszer, de nem élőlény (Gánti, 1975) Autokatalitikus


Forgalmi modellezés BMEKOKUM209

Forgalmi modellezés BMEKOKUM209 BME Közlekedésüzemi és Közlekedésgazdasági Tanszék Forgalmi modellezés BMEKOKUM209 Szimulációs modellezés Dr. Juhász János A forgalmi modellezés célja A közlekedési igények bővülése és a motorizáció növekedése


Paleobiológiai módszerek és modellek 11. hét

Paleobiológiai módszerek és modellek 11. hét Paleobiológiai módszerek és modellek 11. hét A diverzitás fajtái és mérőszámai Nagy őslénytani adatbázisok: Sepkoski The Fossil Record Paleobiology Database A diverzitás fogalma Diverzitás sokféleség az


avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest

avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest Iparilag alkalmazható szekvenciák, avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest Neutrokin α - jelentős kereskedelmi érdekek


Információ megjelenítés Történet és példák. Dr. Iványi Péter

Információ megjelenítés Történet és példák. Dr. Iványi Péter Információ megjelenítés Történet és példák Dr. Iványi Péter Charles Minard (1781-1870) Francia mérnök Napóleon 1812-es oroszországi hadjárata William Playfair (1759-1823) The Commercial and Political Atlas,


Lemezalkatrész modellezés. SolidEdge. alkatrészen

Lemezalkatrész modellezés. SolidEdge. alkatrészen A példa megnevezése: A példa száma: A példa szintje: Modellezõ rendszer: Kapcsolódó TÁMOP tananyag rész: A feladat rövid leírása: Lemezalkatrész modellezés SZIE-A4 alap közepes - haladó SolidEdge CAD 3D


Dimenzióváltás becsapódásos fragmentációban

Dimenzióváltás becsapódásos fragmentációban Dimenzióváltás becsapódásos fragmentációban Pál Gergő Témavezető: Dr. Kun Ferenc Debreceni Egyetem Döffi 2013, Balatonfenyves Heterogén anyagok fragmentációja Próbatest töredezési folyamata - nagy mennyiségű


Lengyelné Dr. Szilágyi Szilvia április 7.

Lengyelné Dr. Szilágyi Szilvia április 7. ME, Anaĺızis Tanszék 2010. április 7. , alapfogalmak 2.1. Definíció A H 1, H 2,..., H n R (ahol n 2 egész szám) nemüres valós számhalmazok H 1 H 2... H n Descartes-szorzatán a következő halmazt értjük:



POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK Dr. Pécs Miklós Budapesti Műszaki és Gazdaságtudományi Egyetem, Alkalmazott Biotechnológia és Élelmiszertudomány Tanszék 1 Glikozilálás A rekombináns fehérjék


Az atommag összetétele, radioaktivitás

Az atommag összetétele, radioaktivitás Az atommag összetétele, radioaktivitás Az atommag alkotórészei proton: pozitív töltésű részecske, töltése egyenlő az elektron töltésével, csak nem negatív, hanem pozitív: 1,6 10-19 C tömege az elektron


Az anyagi rendszerek csoportosítása

Az anyagi rendszerek csoportosítása Általános és szervetlen kémia 1. hét A kémia az anyagok tulajdonságainak leírásával, átalakulásaival, elıállításának lehetıségeivel és felhasználásával foglalkozik. Az általános kémia vizsgálja az anyagi



TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL Az egyes biomolekulák izolálása kulcsfontosságú a biológiai szerepük tisztázásához. Az affinitás kromatográfia egyszerűsége, reprodukálhatósága


Abszorpciós spektroszkópia

Abszorpciós spektroszkópia Tartalomjegyzék Abszorpciós spektroszkópia (Nyitrai Miklós; 2011 február 1.) Dolgozat: május 3. 18:00-20:00. Egész éves anyag. Korábbi dolgozatok nem számítanak bele. Felmentés 80% felett. A fény; Elektromágneses


A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR)

A kovalens kötés elmélete. Kovalens kötésű molekulák geometriája. Molekula geometria. Vegyértékelektronpár taszítási elmélet (VSEPR) 4. előadás A kovalens kötés elmélete Vegyértékelektronpár taszítási elmélet (VSEPR) az atomok kötő és nemkötő elektronpárjai úgy helyezkednek el a térben, hogy egymástól minél távolabb legyenek A központi


A távérzékelt felvételek tematikus kiértékelésének lépései

A távérzékelt felvételek tematikus kiértékelésének lépései A távérzékelt felvételek tematikus kiértékelésének lépései Csornai Gábor László István Földmérési és Távérzékelési Intézet Mezőgazdasági és Vidékfejlesztési Igazgatóság Az előadás 2011-es átdolgozott változata



SZERKEZETFÖLDTANI OKTATÓPROGRAM, VETŐMENTI ELMOZDULÁSOK MODELLEZÉSÉRE. Kaczur Sándor Fintor Krisztián kaczur@gdf.hu, efkrisz@gmail. SZERKEZETFÖLDTANI OKTATÓPROGRAM, VETŐMENTI ELMOZDULÁSOK MODELLEZÉSÉRE Kaczur Sándor Fintor Krisztián kaczur@gdf.hu, efkrisz@gmail.com 2010 Tartalom Földtani modellezés lehetőségei Szimulációs szoftver,
