Save this PDF as:

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "(11) Lajstromszám: E 005 805 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA"


1 !HU T2! (19) HU (11) Lajstromszám: E (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E (22) A bejelentés napja: (96) Az európai bejelentés bejelentési száma: EP (97) Az európai bejelentés közzétételi adatai: EP A (97) Az európai szabadalom megadásának meghirdetési adatai: EP B (1) Int. Cl.: C07K 14/7 (06.01) A61K 38/22 (06.01) A61K 47/48 (06.01) (87) A nemzetközi közzétételi adatok: WO PCT/IB 06/ () Elsõbbségi adatok: 366 P US P US (72) Feltalálók: FINN, Rory Francis, Pfizer Global R. & D., Chesterfield, MO (US); SIEGEL, Ned Roger, Pfizer Global R. & D., Chesterfield, MO (US); SUMMERS, Neena Lynne, St. Charles, MO (US); NARDONE, Nancy Ann, Pfizer Global R. & D., Groton, CT 063 (US) (73) Jogosult: Pfizer Products Incorporated, Groton, CT 063 (US) (74) Képviselõ: dr. Gyõrffy Béla, DANUBIA Szabadalmi és Jogi Iroda Kft., Budapest (4) PYY agonisták és alkalmazásaik (7) Kivonat A találmány tárgya PYY változatok és pegezett származékaik és készítmények és eljárások, amelyek NPY Y2 receptor agonista által modulált állapotok kezelésére szolgálnak. HU T2 A leírás terjedelme 48 oldal (ezen belül 16 lap ábra) Az európai szabadalom ellen, megadásának az Európai Szabadalmi Közlönyben való meghirdetésétõl számított kilenc hónapon belül, felszólalást lehet benyújtani az Európai Szabadalmi Hivatalnál. (Európai Szabadalmi Egyezmény 99. cikk (1)) A fordítást a szabadalmas az 199. évi XXXIII. törvény 84/H. -a szerint nyújtotta be. A fordítás tartalmi helyességét a Magyar Szabadalmi Hivatal nem vizsgálta.

2 1 HU T2 2 A találmány területe A találmány tárgyát képezik PYY agonisták, különösen PYY3 36 variánsok és PYY3 36 és PYY3 36 variánsok pegezett származékai, az ilyen agonistákat tartalmazó készítmények, ilyen PYY agonistákat kódoló izolált nukleinsavak, a találmány tárgya továbbá az ilyen agonisták vagy készítmények alkalmazása elhízás és a hozzá kapcsolódó betegségek kezelésére, vagy emlõsszervezet étvágyának, élelmiszer-bevitelének vagy kalóriabevitelének csökkentésére. A találmány háttere Az elhízás egy fontos közegészségügyi probléma a növekvõ gyakorisága és a hozzá kapcsolódó egészségügyi kockázatok következtében. Továbbá az elhízás befolyásolhatja személy életminõségét a korlátozott mozgékonyságon és a lecsökkent fizikai teljesítõképességen keresztül, valamint a szociális, tanulmányi és munkahelyi diszkrimináció révén. Az elhízottságot és a túlsúlyosságot általánosan a testtömegindex (Body Mass Index, BMI) alkalmazásával definiálják, ami korrelál a teljes testzsírmennyiséggel és egyes betegségek kockázatának mértékeként szolgál. A BMI értékét a kg¹ban megadott testtömeg m¹ben megadott testmagasság négyzetével történõ elosztásával számoljuk ki (kg/m 2 ). A túlsúlyosságot jellemzõen 2 29,9 kg/m 2 BMI-értékkel definiáljuk és az elhízottságot jellemzõen kg/m 2 vagy ennél nagyobb BMI-értékkel definiáljuk. Lásd például National Heart, Lung, and Blood Institute, Clinical Guidelines on the Identification, Evaluation, and Treatment of Overweight and Obesity in Adults, The Evidence Report, Washington, DC: U. S. Department of Health and Human Services, NIH közzétételi szám: (1998). Nemrégiben végzett vizsgálatok azt találták, hogy az elhízottság és a hozzá kapcsolódó egészségügyi kockázatok nem korlátozódnak felnõttekre, hanem meglepõ mértékben érint gyermekeket és serdülõkorúakat is. A Center for Disease Control nevû szervezet szerint a túlsúlyosnak definiált gyermekek és serdülõk százalékos aránya több, mint megkétszerezõdött a korai 1970¹es évek óta, és jelenleg a gyermekek és serdülõkorúak körülbelül 1 százaléka túlsúlyos. A szívbetegségek kockázati tényezõi, mint amilyen a magas koleszterinszint és magas vérnyomás, nagyobb gyakorisággal fordul elõ túlsúlyos gyermekekben és serdülõkorúakban a hasonló korú normális testsúlyú alanyokhoz képest. Továbbá a 2¹es típusú cukorbetegség, amelyet korábban felnõttkori betegségnek tartottak, elõfordulása drámaian megnövekedett gyermekek és serdülõkorúak esetében. A túlsúlyos állapotok és az elhízottság szorosan kapcsolódik a 2¹es típusú cukorbetegséghez. Nemrégiben azt becsülték, hogy a túlsúlyos serdülõkorúaknak 70%¹os az esélyük arra, hogy túlsúlyos vagy elhízott felnõtté váljanak. A valószínûség 80%¹ra növekszik, amennyiben legalább az egyik szülõ túlsúlyos vagy elhízott. A társadalmi diszkrimináció a túlsúlyosság legközvetlenebb következménye, amit a gyermekek maguk is érzékelnek. A túlsúlyos vagy elhízott egyének esetében megnövekszik az olyan betegségek kockázata, mint a magas vérnyomás, diszlipidémia, 2¹es típusú (nem inzulinfüggõ) cukorbetegség, inzulinrezisztencia, glükózintolerancia, hiperinzulinémia, szívkoszorúér-betegség, torokgyulladás, szívszélhûdés, szélütés, epekövek, epehólyag-gyulladás, epekõbántalom, köszvény, csontízületi gyulladás, obstruktív alvási légzésszünet és légzési problémák, epehólyag-betegség, bizonyos rákformák (például: endometriális, mell¹, prosztata- és vastagbél¹) és pszichológiai rendellenességek (mint például depresszió, evési rendellenességek, torzult testkép és kis önbecsülés). Az elhízottság negatív egészségügyi következményei a második megelõzhetõ halálokká teszik az elhízottságot az Egyesült Államokban és jelentõs gazdasági és pszichológiai hatással van a társadalomra. Lásd: McGinnis M, Foege WH., Actual Causes of Death in the United States, JAMA 270:27 12, Az elhízottságot jelenleg krónikus betegségként azonosítják, amely kezelésre szorul a hozzá kapcsolódó egészségügyi kockázatok csökkentésére. Habár a testtömegcsökkenés egy fontos kezelési eredmény, azonban az elhízottság kezelésének az egyik legfontosabb célja a kardiovaszkuláris és metabolikus értékek javítása az elhízottsághoz kapcsolódó morbiditási és mortalitási értékek csökkentésére. Azt találták, hogy %¹os testtömegcsökkenés lényegesen javíthatja az olyan metabolikus értékeket, mint amilyen a vércukorszint, vérnyomás és lipidkoncentrációk. Tehát úgy gondolják, hogy %¹os testtömegcsökkenés csökkentheti a morbiditást és mortalitást. Az elhízottság kezelésére szolgáló jelenleg elérhetõ vényre kapható gyógyszerek általánosan csökkentik a testtömeget a táplálék-zsírfelvétel általános csökkentése révén, mint az orlistat, vagy energiahiány létrehozásával az élelmiszerbevitel csökkentésén keresztül és/vagy az energiafelhasználás növelése révén, amint ez a sibutramine esetén látható. A jelenleg elérhetõ elhízás elleni ágensek alternatíváinak megtalálására végzett kutatás számos úton indult el, amelyek egyike egyes bélpeptidekre fókuszált, amelyekrõl azt mutatták ki, hogy modulálják a jóllakottságot, mint például az YY peptid (PYY). A PYY a hormonok hasnyálmirigyi ( pancreatic polypeptide, PP) családjának tagja [a PP¹vel és az Y neuropeptiddel együtt (NPY)]. Amint a többi családtagok esetén a PYY egy C¹terminálisan amidált, 36 aminosavból álló peptid. Ez egy bél endokrin peptid, amelyet eredetileg sertésbélbõl izoláltak (Tatemoto és Mutt, Nature 28: , 1980) és ezt követõen arról számoltak be, hogy csökkenti patkányok esetében a magas zsírtartalmú élelmiszer-bevitelt periferiális beadást követõen (Okada és munkatársai, Endocrinology Supplement 180, 1993) és egerekben súlycsökkenést vált ki periferiális beadást követõen (Morley és Flood, Life Sciences 41: , 1987). Számos tárolt és cirkuláló PYY forma létezésérõl tudunk (Chen és munkatársai, Gastroenterology 87: , 1984; és Roddy és munkatársai, Regul Pept 18:1 212, 1987). Az egyik ilyen forma, a PYY 3 36, humán vastagbélnyálkahártya-kivonatokból lett izolálva (Eberlein és munkatársai, Peptides : , 1989), és ezt találták a 2

3 1 HU T2 2 PYY domináns formájának a human posztprandiális plazmában (Grandt és munkatársai, Regul. Pept. 1:11 19, 1994). Beszámolók szerint a PYY 3 36 nagy affinitású NPY Y2 receptor (Y2R) szelektív agonista (Keire és munkatársai, Am. J. Physiol. Gastrointest. Liver Physiol. 279:G126-G131, 00). A PYY 3 36 periferiális beadása jelentõsen csökkenti patkányok esetében a táplálékbevitelt és a súlygyarapodást, emberek esetében csökkenti az étvágyat és a táplálékbevitelt, és csökkenti egerek esetében a táplálékbevitelt, de nem csökkenti Y2R-null egerekben, amelyrõl azt gondolták, hogy a táplálékbevitelhez szükséges az Y2R. Humán vizsgálatokban a PYY 3 36 infúziójáról azt találták, hogy szignifikánsan csökkenti az étvágyat és 24 óra alatt 33%-kal csökkenti a táplálékbevitelt. A normális posztprandiális cirkulációs peptidkoncentrációk elérésére végzett PYY 3 36 infúzió csúcs szérum PYY 3 36 szintekhez vezettek 1 percen belül, amit gyors, az alapértékekre történõ csökkenés követett percen belül. Arról számoltak be, hogy a PYY 3 36 infúziót követõ 12 órás idõszakban jelentõs táplálékbevitel-gátlás volt, de lényegében nem volt hatása a táplálékbevitelre a 12 órától 24 óráig terjedõ idõszakban. Egy patkányvizsgálatban az ismételt PYY 3 38 IP (napi kétszeri injekció, 7 napon át) beadás csökkentette az összesített táplálékbevitelt (Batterham és munkatársai, Nature 418: 64, 02). Polipeptidalapú gyógyszerek, amelyek kovalensen vannak polimerekhez, mint például polietilénglikolhoz kapcsolva növelik az in vivo féléletidejüket. Azonban ez gyakran a biológiai vagy farmakológiai aktivitás drasztikus elvesztéséhez vezet (Shechter és munkatársai, FEBS Letters 79: , 0; Fuerteges és Abuchowski, J. Control Release 11: , 1990; Katre, Adv. Drug Del. Sys. :91 114, 1993; Bailon és Berthold, Pharm. Sci. Technol. Today 1:32 36, 1996; Nucci és munkatársai, Adv. Drug Delivery Rev. 6, 1991; Delgado és munkatársai, Critical Rev. Ther. Drug Carrier Syst. 9:249 4, 1992; Fung és munkatársai, Polym. Preprints 38:6 66, 1997; Reddy, Ann. Pharmacother. 34:91 923, 00; Veronese, Biomaterials 22: 417, 01). Például Shechter és munkatársai, fent, arról számoltak be, hogy a PYY 3 36 standard kémiával végzett kd pegezése, stabil kötés kialakításán keresztül ( kd PEG-PYY 3 36 ), a teljes inaktiválásához vezetett egereken végzett táplálékbevitel-vizsgálatokban (sc. injekció). Arról is beszámoltak, hogy a PYY 3 36 reverzíbilis pegezése ( kd PEG- FMS-PYY 3 36 ) a funkcionális féléletidõ nyolcszoros növekedését eredményezte (24 óra a 3 órával szemben). Lásd még a WO 04/ és WO 03/02691 számú nemzetközi szabadalmi bejelentéseket. A találmány összefoglalása A találmány tárgyát képezik PYY agonisták, amelyek hpyy 3 36 variánsai. A találmány egy szempontja szerint a PYY agonista a humán PYY 3 36 variánsa, amelyben a. aminosav (glutaminsav) vagy a 11. aminosav (aszparginsav) ki van cserélve ciszteinre, és amely azzal a funkcióval bír, hogy konjugálható hidrofil polimerrel, mint például polietilénglikollal (PEG). A megfelelõ variánsok tehát a következõk: (EC)PYY 3 36 és (D11C)PVV A találmány egy elõnyös megvalósítási módja szerint a PYY agonista az (EC)hPYY 3 36 polipeptid, amelynek aminosavszekvenciája a következõ: IKPEA- PGCDASPEELNRYYASLRHYLNLVTRQRY-NH 2 [SEQ ID NO:3], vagy gyógyszerészetileg elfogadható sója. A találmány egy további elõnyös megvalósítási módja szerint a PYY agonista a (D11C)hPYY 3 36 polipeptid, amelynek aminosavszekvenciája a következõ: IKPEAPGECASPEELNRYYASLRHYLNLVTRQ- RY-NH 2 [SEQ ID NO:4], vagy gyógyszerészetileg elfogadható sója. Legelõnyösebben az agonista az (EC)hPYY A találmány szerinti PYY agonista elõnyösen konjugálva van hidrofil polimerrel, elõnyösen PEG-gel. Az agonista elõnyösen monopegezett, azaz az agonista:peg arány körülbelül 1:1, ami konjugálható funkciós csoporthoz van kötve. A PEG lehet lineáris, elágazó vagy lelógó; elõnyösebben lineáris vagy elágazó; legelõnyösebben lineáris. A lineáris PEG-eknek, a PEG egyik vége olyan csoporttal van lefedve, amely közömbös a PEG¹et az agonistához kapcsoló körülmények esetén, például étercsoport, elõnyösebben metoxicsoport. Az ilyen módon terminált PEG-eket (azaz metoxicsoporttal) gyakran nevezik mpeg-eknek. A másik vég aktiválva van a PYY agonistához történõ kapcsolódásra. Hasonló módon, a találmányban alkalmazható elágazó PEG¹ek esetén egy kivételével az összes vég le van éterrel fedve, és az éterrel nem lefedett vég van a kapcsolódásra aktiválva. Egy megvalósítási mód szerint a nem éterrel lefedett PEG-vég egy kapcsolórésszel ( L ) van lefedve, amely a PEG¹et egy olyan funkcióscsoporthoz köti, amely reagál a cisztein-aminosav konjugálható funkcióscsoportjával, hogy olyan konjugátum jöjjön létre, amelyben a PEG kovalens módon van a konjugálható funkcióscsoportjához kötve. Egy további megvalósítási mód szerint a PEG közvetlenül van a reaktív csoporthoz kötve kapcsolórész közbeiktatása nélkül. Az ilyen PEG-eket gyakran nevezik kapcsoló nélküli PEG-eknek. Az (EC)hPYY 3 36 és (D11C)hPYY 3 36 polipeptidek esetén a PEG nem lefedett vége elõnyösen egy kapcsolóhoz van kötve, amely a PEG¹et maleimidvagy egyéb csoporthoz köti, amely reagál a ciszteinaminosav tioljával, hogy ezáltal olyan konjugátum jöjjön létre, ahol a PEG kovalensen van kötve a cisztein tiolcsoportjához. Az (EC)hPYY 3 36 vagy (D11C)PYY 3 36 peptiddel alkalmazható megfelelõ reaktív PEG-ekhez tartoznak a következõ képletû PEG¹ek:, 3

4 1 HU T2 2 mpeg SO 2 CH CH 2, mpeg HN COCH 2 I és Elõnyösen a PEG a fent ismertetett mpeg-maleimid, amely tartalmaz kapcsolórészt, L. A kapcsolórész nélküli PEG-maleimidek szintén alkalmasak a találmányban történõ alkalmazásra, különösen az (EC)hPYY 3 36 vagy (D11C)PYY 3 36 peptidekkel. Az ilyen kapcsolórész nélküli PEG-maleimidek elõállíthatóak, amint azt Goodson és Katre ismertették, Bio/Technology 8: , Az (EC)hPYY 3 36 vagy (D11C)PYY 3 36 polipeptidek és a fent ismertetett mpeg¹ek párosításával elõállított konjugátumokat a következõ képletekkel ismertetjük, ahol SR jelentése (EC)hPYY 3 36 vagy (D11C)PYY 3 36 polipeptid, amelyben S a cisztein tiolcsoportjának kénatomját jelöli:., mpeg SO 2 CH 2 CH 2 SR, mpeg HN COCH 2 SR és mpeg S SR. A kapcsoló L csupán arra szolgál, hogy összekapcsolja a PEG¹et a reaktív funkcióscsoporttal és ezért nem különösen korlátozó, de elõnyösen tartalmaz észterkötést, uretánkötést, amidkötést, éterkötést, karbonátkötést, vagy másodlagos aminocsoportot tartalmazó alkiléncsoportot. Egy elõnyös megvalósítási mód szerint, különösen lineáris PEG¹ek esetén a kapcsoló a következõ képletû csoport: O(CH 2 ) p NHC(O)(CH 2 ) r, amelyben p jelentése 1 és 6 közötti egész szám, elõnyösen, 1 és 3 közötti, még elõnyösebben, 2 vagy 3, legelõnyösebben 3, és r jelentése 1 és 6 közötti egész szám, elõnyösen, 1 és 3 közötti, még elõnyösebben, 2 vagy 3, legelõnyösebben 2. Egy elõnyös kapcsoló a következõ csoport: CH 2 CH 2 CH 2 NHCOCH 2 CH 2, Egy további elõnyös megvalósítási mód szerint, különösen elágazó PEG¹ek esetében a kapcsoló a következõ képletû csoport: NHC(O)(CH 2 ) s, amelyben s jelentése 1 és 6 közötti egész szám, elõnyösen, 1 és 3 közötti, még elõnyösebben, 2 vagy 3, legelõnyösebben 2. Egy elõnyös kapcsoló a következõ csoport: NHC(O)CH 2 CH 2. A PEG lehet lineáris vagy nem lineáris, például elágazó vagy lelógó. Elõnyösen a PEG lineáris vagy elágazó, elõnyösen lineáris vagy elágazó mpeg-maleimid. Glicerinelágazó mpeg-maleimid egy elõnyös elágazó PEG. Elõnyösen a PEG lineáris mpeg-maleimid. A PEG-nek elõnyösen az átlagos molekulatömege a körülbelül 1 kd körülbelül 0 kd tartományba esik. Elõnyösen az átlagos molekulatömege a körülbelül kd körülbelül 4 kd tartományba esik; elõnyösebben az átlagos molekulatömege körülbelül 12 kd körülbelül 4 kd, vagy körülbelül kd körülbelül 4 kd. Különösen jelentõs a lineáris mpeg, mint például amilyet az (1) képleten mutattunk be, amelynek az átlagos molekulatömege körülbelül vagy körülbelül kd. A (2) képlet szerinti glicerinelágazó mpeg szintén jelentõs és elõnyösen az átlagos molekulatömege körülbelül kd vagy körülbelül 43 kd. Az elõnyös PEG¹ek, amelyek aktiválva vannak az (EC)hPYY 3 36 vagy (D11C)PYY 3 36 peptidek cisztein-tiolcsoportjával történõ konjugációra az (1) és (2) képlet szerinti vegyületek. Az (1) képlet szerinti lineáris mpeg-ben n jelentése egy körülbelül tartományba esõ egész szám; elõnyösen, körülbelül 37 2 vagy körülbelül 0 70, vagy körülbelül vagy körülbelül 700, vagy körülbelül vagy A (2) képlet szerinti glicerinelágazó mpeg-ben minden egyes m jelentése körülbelül azonos és körülbelül 00 tartományba esõ egész szám; elõnyösen körülbelül 1 28 vagy körülbelül 0 2, vagy körülbelül 0 vagy Sokféle PEG, amelyek peptid-aminosavak oldalláncaiban lévõ célfunkcióscsoportokhoz, például keto, tiol, hidroxi, karboxi, vagy szabad amino funkcióscsoportok, történõ konjugálásra aktiválva vannak elérhetõk a kereskedelemben számos szállítótól, például a következõktõl: NOF Corporation, Tokió, Japán, vagy Nektar Therapeutics Corporation, Huntsville, AL. A találmány egy további szempontja szerint a találmány tárgya a PYY variánsok és polietilénglikol konjugátumai. 4

5 1 HU T2 2 Egy megvalósítási mód szerint a konjugátum a (3) képlet szerinti: 3 ahol az mpeg-rész lineáris vagy elágazó és az átlagos molekulatömege a körülbelül 1 kd 0 kd tartományba esik, elõnyösen, kd körülbelül 4 kd, elõnyösebben körülbelül kd vagy 12 kd körülbelül kd vagy 4 kd, vagy körülbelül kd körülbelül kd vagy 4 kd, L jelentése a következõ képlet szerinti csoport: O(CH 2 ) p NHC(O)(CH 2 ) r amelyben p jelentése 1 és 6 közötti egész szám, elõnyösen, 1 és 3 közötti, még elõnyösebben, 2 vagy 3, legelõnyösebben 3, és r jelentése 1 és 6 közötti egész szám, elõnyösen, 1 és 3 közötti, még elõnyösebben, 2 vagy 3, legelõnyösebben 2; vagy L jelentése a következõ képlet szerinti csoport: NHC(O)(CH 2 ) s amelyben s jelentése 1 és 6 közötti egész szám, elõnyösen, 1 és 3 közötti, még elõnyösebben, 2 vagy 3, legelõnyösebben 2; és SR jelentése az (EC)hPVV 3 36 vagy (D11C)hPYY 3 36 polipeptid, amelyben S a cisztein-tiolcsoport kénatomját jelöli. A találmány egy elõnyös megvalósítási módja szerint a találmány tárgya a (4) képlet szerinti lineáris mpeg-pyy 3 36 variáns konjugátum 4 ahol n jelentése körülbelül tartományba esõ egész szám; elõnyösen körülbelül 37 2 vagy körülbelül 0 70, vagy körülbelül vagy körülbelül ; és SR jelentése (EC)hPVV 3 36 vagy (D11C)hPYY 3 36 polipeptid, amelyben S a cisztein-tiolcsoport kénatomját jelöli; vagy gyógyszerészetileg elfogadható sója. Elõnyösen a (CH 2 CH 2 O) n rész átlagos molekulatömege körülbelül kd vagy kd. Különösen jelentõs az a konjugátum, amelyben az SR az (EC)hPYY 3 36 polipeptid. Egy további szempont szerint a találmány tárgya olyan konjugátum, amelyben a PEG-rész elágazó. Ezen kategória elõnyös konjugátumai tartalmaznak glicerinelágazó PEG-részt. Különösen jelentõs az () képlet szerinti konjugátum: ahol minden egyes m jelentése körülbelül azonos és körülbelül 0 tartományba esõ egész szám; elõnyösen körülbelül 1 28 vagy körülbelül 0 2, vagy körülbelül 0 vagy körülbelül 00, és SR jelentése (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 polipeptid, amelyben S a cisztein-tiolcsoport kénatomját jelöli; vagy gyógyszerészetileg elfogadható sója. Elõnyösen minden egyes (CH 2 CH 2 O) m rész molekulatömege a körülbelül 9 11 kd vagy körülbelül 22 kd tartományba esik. Elõnyösen a kombinált átlagos molekulatömege a (CH 2 CH 2 O) m részeknek körülbelül kd vagy körülbelül 43 kd. Különösen jelentõs az a konjugátum, amelyben az SR az (EC)hPYY 3 36 polipeptid. A találmány tárgya továbbá monoklonális antitest, amely specifikusan kötõdik olyan polipeptidhez, amely tartalmazza a 3. vagy 4. azonosító számú szekvencián bemutatott aminosavszekvenciát. A találmány ezen szempontjának egy megvalósítási módja szerint a polipeptid pegezett a cisztein-aminosavnál. Továbbá a találmány tárgya polinukleotidszekvencia, amely a találmány szerinti polipeptidszekvenciát kódolja, elõnyösen a 3. vagy 4. azonosító számú szekvenciát kódolja. A találmány egy további megvalósítási módja szerint a találmány tárgya gyógyászati készítmény, amely a találmány szerinti PYY agonistát és gyógyszerészetileg elfogadható hordozót tartalmaz. Egy további megvalósítási mód szerint a készítmény tartalmaz továbbá legalább egy további gyógyászati ágenst, amely lehet olyan ágens, amely alkalmas a készítmény elsõdleges indikációjának kezelésére vagy az elsõdleges indikációval együtt járó betegség kezelésére. A további gyógyászati ágens elõnyösen elhízás elleni ágens. A készítmény elõnyösen tartalmazza a találmány szerinti PYY agonista terápiásan hatásos mennyiségét vagy a találmány szerinti PYY agonista és a további gyógyászati ágens terápiásan hatásos mennyiségét. A találmány tárgya továbbá a jelen vegyületek alkalmazása gyógyszer elõállítására, amely gyógyszer a következõkben történõ alkalmazásra szolgál: emlõsökben Y2R agonista által modulált betegség, állapot vagy rendellenesség kezelésére szolgáló eljárás, amely tartalmazza ilyen kezelésre szükséget mutató emlõsnek a találmány szerinti PYY agonista hatásos mennyiségének periferiális beadását. A találmány szerinti PYY

6 1 HU T2 2 agonista alkalmazható önmagában vagy legalább egy gyógyszerészeti ágenssel kombinációban, amely ágens alkalmas betegség, állapot vagy rendellenesség, vagy együttesen elõforduló betegség, állapot vagy rendellenesség kezelésére. Emlõsökben Y2R agonista által modulált betegségek, állapotok vagy rendellenességek közé tartozik az elhízottság és a túlsúlyosság. Az ilyen betegségek, állapotok vagy rendellenességekkel együttesen elõforduló betegségek valószínûleg egyidejûleg javulnának az ilyen betegségek, állapotok vagy rendellenességek kezelésével. A találmány tárgya továbbá a jelen vegyületek alkalmazása gyógyszer elõállítására, amely gyógyszer a következõkben történõ alkalmazásra szolgál: ilyen kezelésre szükséget mutató emlõs elhízottságának kezelése, amely tartalmazza a találmány szerinti PYY agonista hatásos mennyiségének periferiális beadását az emlõsnek. A találmány tárgya továbbá eljárás tömegcsökkentésre vagy tömegcsökkentés elõsegítésére (ideértve a súlygyarapodás megelõzését és meggátlását) emlõsben, amely eljárás tartalmazza a találmány szerinti PYY agonista súlykontrolláló vagy súlycsökkentõ mennyiségének periferiális beadását az emlõsnek. A találmány tárgya továbbá eljárás táplálékbevitel csökkentésére emlõsben, amely eljárás tartalmazza a találmány szerinti PYY agonista táplálékbevitel-csökkentõ mennyiségének periferiális beadását az emlõsnek. A találmány tárgya továbbá eljárás jóllakottság érzetének elõidézésére emlõsben, amely eljárás tartalmazza a találmány szerinti PYY agonista jóllakottságot elõidézõ mennyiségének periferiális beadását az emlõsnek. A találmány tárgya továbbá eljárás kalóriabevitelcsökkentésre emlõsben, amely eljárás tartalmazza a találmány szerinti PYY agonista kalóriabevitelt csökkentõ mennyiségének periferiális beadását az emlõsnek. A PYY agonista beadható önmagában vagy legalább egy gyógyászati hatóanyaggal kombinációban, elõnyösen elhízás elleni ágenssel kombinációban. Az itt ismertetett eljárások mindegyikében és a kapcsolódó igénypontokban a PYY agonista beadható önmagában vagy legalább egy gyógyászati hatóanyaggal kombinációban, elõnyösen elhízás elleni ágenssel kombinációban. A PYY agonisták és az õket tartalmazó készítmények szintén alkalmasak az itt említett terápiás alkalmazásokra szolgáló gyógyszerek elõállítására Definíciók és rövidítések A gyógyászatilag elfogadható kifejezés azt jelenti, hogy az anyag vagy készítmény kémiailag és/vagy toxikológiailag kompetens kell, hogy legyen a kiszerelés további összetevõivel, és/vagy a vele kezelt emlõssel. A PYY agonista kifejezés, bármely olyan vegyületet jelöl, amely hpyy 3 36 által kiváltott egy vagy több hatással megegyezõ hatást vált ki in vivo vagy in vitro. A terápiásan hatásos mennyiség kifejezés a találmány szerinti PYY agonista olyan mennyiségét jelenti, amely csökkenti a kalóriabevitelt, csökkenti a testtömeget és/vagy csökkenti a testzsírt a megfelelõ kontrollértékekhez képest, amelyek a kezelést megelõzõen lettek meghatározva vagy hordozóval kezelt csoportban. Az emlõs kifejezés jelent embert, valamint az állatkirályság további meleg vérû tagjait, amelyeknek az emlõsosztályra jellemzõ homeosztatikus mechanizmusaik vannak, például társemlõsök, állatkerti emlõsök és táplálékforrás-emlõsök. A társként szolgáló emlõsök néhány példája a kutyafélék (például kutyák), macskafélék (például macskák) és a lovak; a táplálékforrásemlõsök néhány példája közé tartoznak a disznók, szarvasmarhák, juhok és a hasonlók. Elõnyösen az emlõs ember vagy társemlõs. Legelõnyösebben az emlõs ember, férfi vagy nõ. A kezelni, kezel vagy kezelés kifejezések magukban foglalnak mind megelõzõ, azaz profilaktikus, mind palliatív kezelést. A periferiális beadás kifejezés azt jelenti, hogy a beadás a központi idegrendszeren kívül történik. A periferiális beadás nem tartalmazza az agyba történõ közvetlen beadást. A periferiális beadás tartalmazza, nem korlátozó módon, a következõ beadási módokat: intravaszkuláris, intramuszkuláris, szubkután, inhalációs, orális, nyelv alatti, enterális, rektális, transzdermális vagy intranazális. A human PYY vagy hpyy kifejezés 36¹aminosavas C¹terminálisan amidált polipeptidet jelöl, amelynek az aminosavszekvenciája a következõ: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQ- RY-NH 2 [SEC ID NO:1] A hpyy 3 36 kifejezés a hpyy C¹terminális 34¹merét jelöli, amelynek az aminosavszekvenciája a következõ: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQ- RY-NH 2 [SEQ ID NO:2] A (EC)hPYY 3 36 kifejezés a hpyy C¹terminális 34¹merét jelöli, amelyben a ¹es glutaminsav ciszteinre van cserélve, és amelynek az aminosavszekvenciája a következõ: IKPEAPGCDASPEELNRYYASLRHYLNLVTRQ- RY-NH 2 [SEQ ID NO:3]. A (D11C)hPYY 3 36 kifejezés a hpyy C¹terminális 34¹merét jelöli, amelyben a 11¹es aszparaginsav ciszteinre van cserélve, és amelynek az aminosavszekvenciája a következõ: IKPEAPGECASPEELNRYYASLRHYLNLVTRQ- RY-NH 2 [SEQ ID NO:4]. Az ábrák rövid ismertetése Az 1. ábra fordított fázisú HPLC, amely a tisztított (EC)hPYY 3 36 peptidet követi Zorbax Eclipse XDB¹C8 oszlopon. A 2. ábra méretkizárásos HPLC, amely a lineáris K mpeg-maleimid és az (EC)hPYY 3 36 reakcióelegyet követi Shodex 804 SEC oszlopon. A 3. ábra SP Hitrap tisztításból származó lineáris K mpeg-maleimid és az (EC)hPYY 3 36 frakciók SDS PAGE fo- 6

7 1 HU T tója. MT=molekulatömeg standardok; L=oszloptöltet; FT=átáramlás; 4 23=elúciós frakciók. A 4. ábra fordított fázisú HPLC, amely a tisztított (D11C)hPYY 3 36 peptidet követi Zorbax Eclipse XDB¹C8 oszlopon. Az. ábra méretkizárásos HPLC, amely a lineáris K mpeg-maleimid és a (D11C)hPYY 3 36 reakcióelegyet követi Shodex 804 SEC oszlopon. A 6. ábra méretkizárásos HPLC, amely a tisztított lineáris K mpeg-maleimid és a (D11C)hPYY 3 36 terméket követi és mutatja az elúciós profilját Shodex 804 SEC oszlopon. A 7. ábra méretkizárásos HPLC, amely a tisztított lineáris K mpeg-maleimid és a (D11C)hPYY 3 36 terméket követi és mutatja az elúciós profilját Shodex 804 SEC oszlopon. A 8. ábra méretkizárásos HPLC, amely a glicerinelágazó 43K mpeg-maleimid és az (EC)hPYY 3 36 reakcióelegyet követi Shodex 804 SEC oszlopon. A 9. ábra méretkizárásos HPLC, amely a glicerinelágazó 43K mpeg-maleimid és az (EC)hPYY 3 36 terméket követi és mutatja az elúciós profilját Shodex 804 SEC oszlopon. A. ábra a kumulatív táplálékbevitel gátlásának grafikonja éheztetett egereknél intraperitoneális (IP) injekciót követõen. A A. ábra a natív PYY 3 36 dózishatását mutatja a hordozós csoporthoz képest. A B. ábra a lineáris K mpegmaleimid (EC)hPYY 3 36 dózishatását mutatja. A 11. ábra IP injekció esetében mutatja a glicerinelágazó 43K mpeg-maleimid (EC)PYY 3 36 és a hordozó és a lineáris K mpeg-maleimid (EC)PYY 3 36 összehasonlító táplálékbevitel hatását éheztetett egereken. A 11A. ábra egy vonalgrafikon, amely az injekciót követõen 6 órával mutatja a választ. A 11B. ábra egy oszlopdiagram, amely összehasonlítja a hatásokat az injekciót követõen 24 órával. A 12. ábra a hordozó, PYY 3 36, és lineáris K mpeg-maleimid (EC)PYY 3 36 hatását mutatja IP injekció esetén, spontán módon táplált egerek esetében. A 12A. ábra a táplálékbevitel hatását mutatja, és a 12B. ábra a testtömegre kifejtett hatást mutatja. A 13. ábra a hordozó, PYY 3 36, és lineáris K mpeg-maleimid (EC)PYY 3 36 hatását mutatja szubkután (SC) injekció esetén, spontán módon táplált egerek esetében. A 13A. ábra a táplálékbevitel hatását mutatja, és a 13B. ábra a testtömegre kifejtett hatást mutatja. A 14. ábra a plazmakitettséget mutatja PYY¹ra egerekben 0,1 mg/kg IP injekciót követõen. A 14A. ábra demonstrálja a plazma PYY szinteket hpyy 3 36 injekcióját követõen és a 14B. ábra demonstrálja a plazma PYY szinteket lineáris K mpeg-maleimid (EC)hPYY 3 36 injekcióját követõen. A 1. ábra egy koncentrációválasz-görbe a PYY 3 36 peptidre vagy a lineáris K mpeg-maleimid (EC)PYY 3 36 peptidre szcintillációs közelségvizsgálatból ( Scintillation Proximity Assay, SPA), amelyben a ligandok versengenek a 12 I-PYY 1 36 peptiddel a KAN¹TS sejteken expresszált Y2R-hez történõ kötõdésért. A 16. ábra egy koncentrációválasz-görbe a PYY 3 36 peptidre vagy a lineáris K mpeg-maleimid (EC)PYY 3 36 peptidre GTPgamma[ 3 S] kötõdésvizsgálatból, ahol a KAN¹TS membránokon expresszált Y2R-hez kötõdik. A találmány részletes ismertetése A találmány tárgyát képezik PYY agonisták, amelyek a hpyy 3 36 variánsai és pegezett konjugátumai, amelyeknek lehet legalább egy, a következõk közül nem korlátozó módon választott, javított kémiai vagy fiziológiai tulajdonságuk: lecsökkent kiürülési sebesség, megnövelt plazmatartózkodási idõ, kinyújtott in vivo aktivitás, megnövelt hatásosság, megnövelt stabilitás, megnövelt szolubilizálhatóság és lecsökkentett antigenikusság. A találmány egy elõnyös a PYY variánsa az (EC)hPYY További elõnyös variáns a (D11C)hPYY A találmány ezen variánsai elõállíthatóak szintetikusan és rekombináns vagy egyéb módokon, amint azt az alábbiakban ismertettük a példákban vagy ezekkel analóg eljárásokkal. Szintetikus elõállítás A találmány szerinti PYY variánsok, például (EC)hPYY 3 36 és (D11C)hPYY 3 36, elõállíthatóak a szakterületen ismert standard peptidszintézis-eljárásokkal, például szilárd fázisú peptidszintézissel, amelyet automata peptidszintetizátorral végzünk (például: 433A modell; Applied Biosystems, Foster City, CA) a tboc vagy Fmoc kémia alkalmazásával. A számos elérhetõ peptidszintézis-eljárás egy összefoglalója megtalálható a következõben: Solid Phase Peptide Synthesis 2. kiad. (Stewart, J. M. és Young, J. D., Pierce Chemical Company, Rockford, IL, 1984). Lásd még a Solidphase Organic Synthesis címû könyvet (Burgess, K., John Wiley & Sons, New York, NY, 00) és Engels és munkatársai szakcikkét, Angew. Chem. Intl. Ed. 28:716 34, A fenti hivatkozások hivatkozásként a leírás részét képezik. 7

8 1 HU T2 2 A találmány szerinti PYY variánsokat elõnyösen PEG-gel konjugáljuk. A konjugáló reakciókat, amelyekre pegezõ reakcióként hivatkoznak, történeti okokból oldatban végezték a polimer moláris feleslegében és tekintet nélkül arra, hogy a polimer pontosan hova is kapcsolódott a fehérjéhez. Az ilyen általános eljárásokról azonban jellemzõen bebizonyították, hogy nem megfelelõek bioaktív fehérjék konjugálására nem antigén polimerekhez, hogy közben elégséges biológiai aktivitásuk maradjon. A PYY 3 36 agonistavariáns pegezést követõ bioaktivitásának fenntartására egy módja, hogy lényegében elkerüljük a kapcsolási folyamat során a variáns bármely reaktív csoportjának konjugációját, amely kapcsolódik az agonistának a célreceptorhoz való kötõdéséhez. A találmány egy szempontja szerint a találmány tárgya eljárás polietilénglikolnak a találmány szerinti PYY variáns agonistához való konjugálására, ami specifikus reakciós helyeken történik, amelyek lényegében nem interferálnak a receptor kötõhely(ek)kel, annak érdekében, hogy magas szintû aktivitás maradjon. A találmány egy további szempontja reaktív aminosavak inszerciója a PYY 3 36 peptidbe, hogy ezáltal az agonista variánsainak a polietilénglikollal történõ konjugáció során korlátozott aktivitásváltozásuk legyen. A kovalens kötésen keresztüli kémiai módosítás elvégezhetõ bármilyen megfelelõ feltételek mellett, amelyeket általánosan biológiailag aktív anyag és aktivált PEG konjugálási reakciójára adaptáltak. A konjugációs reakciót viszonylag enyhe körülmények között végezzük, hogy elkerüljük a PYY variáns agonista inaktiválását. Az enyhe körülmények magukban foglalják a reakcióoldat ph¹értékének a körülbelül 3 tartományban tartását, és a reakció-hõmérsékletnek a körülbelül 0 C tartományban tartását. A PYY variánsok nem cél funkcióscsoportjai, amelyek reaktívak a pegezési körülmények között az aktivált PEG-gel, elõnyösen védve vannak megfelelõ védõcsoporttal, amely eltávolítható a célfunkcióscsoportról a pegezést követõen. A szabad aminosavak pegezése során, ahol olyan reagenseket alkalmazunk, mint például PEG aldehidek vagy PEG szukcinimidek, jellemzõen a ph¹értéket a körülbelül 3 tartományban tartjuk, elõnyösen körülbelül 4 7, értéken. A kapcsolóreakció elõnyösen megfelelõ pufferben van elvégezve (ph=3 ), például, foszfát, MES, citrát, acetát, szukcinát vagy HEPES, körülbelül 1 48 óráig, körülbelül 4 C tartományba esõ hõmérsékleten. A pegezés során a tiolcsoportokat alkalmazó reagensek esetén, mint például a PEG-maleimidek, PEG-vinil-szulfonok vagy PEG-ortopiridil-diszulfidok, elõnyösen körülbelül 4 8 tartománybeli ph¹értéket tartunk fenn. A PEG-aminok alkalmasak ketocsoportok pegezésére, például p¹acetil-fenil-alanin és elõállíthatók, amint azt Pillai és munkatársai ismertették, J. Org. Chem. 4: , A találmány szerinti konjugálási reakciók jellemzõen olyan reakciókeveréket adnak, amely tartalmazza a kívánt monopegezett PYY variánst, valamint az el nem reagált PYY variánspeptidet, el nem reagált PEG¹et, és általában kevesebb mint körülbelül % nagy molekulatömegû anyagok, amely tartalmazhat olyan konjugátumokat, amelyek több, mint egy PEGszálat tartalmaznak és/vagy aggregálódtak. A nem reagált anyagok és a nagy molekulatömegû anyagok eltávolítását követõen, kinyerjük az elsõdlegesen egyszeresen pegezett PYY variánsokat tartalmazó készítményeket. Mivel a konjugátumok gyakran egyetlen polimerszálat tartalmaznak, ezért a konjugátum lényegében homogén. A kívánt PEG-PYY variáns konjugátum tisztítható a reakcióelegybõl fehérjék tisztítására jellemzõen alkalmazott, hagyományos eljárásokkal, mint például dialízissel, kisózással, ultraszûréssel, ioncsere-kromatográfiával, hidrofób kölcsönhatásos kromatográfiával (HIC), gélkromatográfiával és elektroforézissel. Az ioncsere-kromatográfia különösen hatásos az el nem reagált PEG vagy az el nem reagált PYY variáns eltávolítására. A kívánt PEG-variáns konjugátum elválasztása végrehajtható a kevert anyagot tartalmazó reakcióelegy körülbelül 4 körülbelül ph¹értékû, elõnyösen alacsonyabb, mint 8 értékû pufferoldatba helyezésével a deamidálás elkerülésére. A pufferoldat elõnyösen, nem korlátozó módon, a következõk közül választott egy vagy több puffersót tartalmazza: KCl, NaCl, K 2 HPO 4, KH 2 PO 4, Na 2 HPO 4, NaH 2 PO 4, NaHCO 3, NaBO 4 és CH 3 CO 2 Na. Amennyiben a pegezési reakcióban alkalmazott pufferrendszer különbözik az elválasztási eljárás során alkalmazottól, akkor a pegezési elegyet puffercserének/diaszûrésnek vetjük alá, vagy hígítjuk a kezdeti elválasztási puffer elégséges mennyiségével. A konjugátumok frakcionálását egy olyan keverékbe, amely tartalmazza a kívánt típusokat, ioncsere-kromatográfiás közeg alkalmazásával végezzük. Az ilyen közeg képes a PEG-PYY variáns konjugátumok szelektív megkötésére a töltésben lévõ különbségek révén, amelyek bizonyos mértékig elõre jelezhetõ mértékben változnak. Például a PYY variáns felszíni töltése meghatározható a peptid felszínén lévõ, az oszloptöltettel kölcsönhatásra elérhetõ töltött csoportok számából, amelyeket nem kompromittál a PEG jelenléte. Ezek a töltött csoportok jellemzõen kapcsolódási pontként szolgálnak a PEG polimereknek. Tehát a PEG-PYY variáns konjugátumoknak a többi jelen lévõ típustól eltérõ töltésük lesz, ami lehetõvé teszi a szelektív izolálást. A jelen PEG-PYY variáns konjugátumok tisztítására különösen elõnyösek az ioncserélõ gyanták. A kationcserélõ gyanták, mint például a szulfopropil gyanták vannak alkalmazva a találmány szerinti tisztítási eljárásban. A jelen találmánynak megfelelõ kationcserélõ gyanták nem korlátozó listája tartalmazza a következõket: SP¹hitrap, SP Sepharose HP és SP Sepharose fast flow. További megfelelõ kationcserélõ gyanták, például S és CM gyanták is alkalmazhatóak. A kationcserélõ gyanta elõnyösen oszlopba van töltve és hagyományos módon van ekvilibrálva. Olyan puffert alkalmazunk, amelynek megegyezik a ph¹értéke és az ozmolaritása a PEG-konjugált PYY variáns oldatáéval. Az elúciós puffer elõnyösen, nem kor- 8

9 1 HU T2 2 látozó módon, egy vagy több a következõk közül választott sót tartalmaz: CH 3 CO 2 Na, HEPES, KCl, NaCl, K 2 HPO 4, KH 2 PO 4, Na 2 HPO 4, NaH 2 PO 4, NaHCO 3, NaBO 4 és (NH 4 ) 2 CO 3. A konjugátumot tartalmazó oldat ezt követõen az oszlopra van adszorbeálva az el nem reagált PEG-gel és valamennyi nagy molekulatömegû anyaggal, ami nincs visszatartva. A töltés befejezésekor elúciós puffer gradiensáramát növekvõ sókoncentrációval alkalmazunk az oszlopon, hogy eluáljuk a kívánt PEG-konjugált PYY 3 36 variáns frakcióját. Az eluált összegyûjtött frakciók elõnyösen egységes polimerkonjugátumokra vannak osztva a kationcserélõ elválasztási lépést követõen. Bármilyen nem konjugált PYY variáns ezt követõen lemosható az oszlopról hagyományos technikákkal. Kívánt esetben mono- és többszörösen pegezett PYY variánsok és nagyobb molekulatömegû anyagok tovább választhatóak el egymástól további ioncserélõ kromatográfiával vagy méretkizárásos kromatográfiával. Növekvõ koncentrációk többszörös izokratikus lépéseit alkalmazó technikák alkalmazhatóak a lineáris gradiens helyett. Növekvõ koncentrációk többszörös izokratikus lépései a többszörösen pegezett/aggregált és ezt követõen a monopegezett PYY variáns konjugátumok szekvenciális elúcióját fogják eredményezni. ph¹gradiensen alapuló elúciós technikák is alkalmazhatóak. Az elúció hõmérséklet-tartománya általánosan körülbelül 4 C és körülbelül 2 C közötti. A PEG-PYY variáns elúcióját UV abszorbanciával követjük 280 nm¹en. A frakciók begyûjtése elvégezhetõ egyszerû idõbeli elúciós profilokkal. Rekombináns expresszió Nukleinsavmolekulák Az (EC)hPYY polipeptidet kódoló nukleinsavmolekulák tartalmazhatják a következõ nukleinsavszekvenciákat (az EC szubsztitúció kodonmutációit aláhúztuk): atcaaacccgaggctcccggctgtgacgcctcgccggaggagctg aaccgctactacgcctccctgcgccactacctcaacctggtcacccggca gcg gtat (SEQ ID NO: ); vagy atcaaacccgaggctcccggctgcgacgcctcgccggaggagctg aaccgctactacgcctccctgcgccactacctcaacctggtcacccggca gc ggtat (SEQ ID NO: 6). A (D11C)hPYY 3 36 polipeptidet kódoló nukleinsavmolekulák tartalmazhatják a következõ nukleinsavszekvenciákat (a D11C szubsztitúció kodonmutációit aláhúztuk): atcaaacccgaggctcccggcgaatgtgcctcgccggaggagctg aaccgctactacgcctccctgcgccactacctcaacctggtcacccggca gcg gtat (SEQ ID NO: 7); vagy atcaaacccgaggctcccggcgaatgcgcctcgccggaggagctg aaccgctactacgcctccctgcgccactacctcaacctggtcacccggca gc ggtat (SEQ ID NO: 8). Ezek a szekvenciák tartalmazhatnak stopkodont (például: tga, taa, tag) a C¹terminális végen és számos módon elõállíthatóak, amelyek közé korlátozások nélkül tartoznak a következõk: kémiai szintézis, cdns vagy genomikus könyvtár szkrínelés, expressziós könyvtár szkrínelés alkalmazásával elõállított vad típusú hpyy polinukleotid genetikai mutációja, és/vagy cdns-polimeráz-láncreakcióval (PCR) végzett amplifikálása. Az (EC)hPYY 3 36 és (D11C)hPYY 3 36 variánsokat kódoló nukleinsavmolekulák elõállíthatóak helyirányított mutagenezissel, PCR amplifikációval és egyéb megfelelõ eljárásokkal, ahol a primer(ek)nek a kívánt pontmutációjuk van. Az itt ismertetett rekombináns DNS-eljárások és mutagenezis eljárások általánosan olyanok, mint amilyeneket ismertetnek a következõk: Sambrook és munkatársai, Molecular Cloning: A Laboratory Manual (Cold Spring Harbor Laboratory Press, 1989) és Current Protocols in Molecular Biology (Ausubel és munkatársai, kiad., Green Publishers Inc. és Wiley and Sons 1994). Amennyiben szükségessé válik, hogy egyéb természetben nem elõforduló aminosavra legyen az E vagy D11 cserélve, akkor az ilyen peptid expresszálható rekombinánsan például a 0/0836 számú USA szabadalmi bejelentésben ismertetettek szerint, amelyet hivatkozásként a leírás részévé teszünk. A hpyy-okat kódoló nukleinsav-polinukleotidok azonosíthatóak expressziós klónozással, ami a pozitív klónok detektálását alkalmazza, az expresszált fehérje tulajdonsága alapján. Jellemzõen nukleinsavkönyvtárak vannak szkrínelve antitest vagy egyéb kötõpartner kötésével (például receptor vagy ligand) a klónozott fehérjékhez, amelyek expresszálva vannak és be vannak mutatva egy gazdasejt felszínén. Az antitest vagy kötõpartner detektálható jelöléssel van módosítva, azon sejtek azonosítására, amelyek expresszálják a kívánt klónt. Az alább ismertetetteknek megfelelõen végrehajtott rekombináns expressziós technikák követhetõek az (EC)hPYY 3 36 és (D11C)hPYY 3 36 kódoló polinukleotidok elõállítására és a kódolt polipeptidek expresszálására. Például olyan nukleinsavszekvencia egy megfelelõ vektorba történõ inszerciójával, amely egy (EC)hPYY 3 36 ¹ vagy (D11C)hPYY variáns aminosavszekvenciáját kódolja, szakember egyszerûen tud nagy mennyiségeket elõállítani a kívánt nukleotidszekvenciából. A szekvenciák ezt követõen alkalmazhatóak detektálási próbák vagy amplifikációs primerek elõállítására. Alternatív esetben egy (EC)hPYY 3 36 ¹ vagy egy (D11C)hPYY polipeptid aminosavszekvenciáját kódoló polinukleotid inszertálható egy expressziós vektorba. Az expressziós vektor megfelelõ gazdába történõ bejuttatásával a kódolt (EC)hPYY 3 36 ¹ vagy (D11C)hPYY variáns nagy mennyiségben elõállítható. A megfelelõ nukleinsavszekvencia elõállításának további módszere a polimeráz-láncreakció (PCR). Ebben az eljárásban, cdns¹t állítunk elõ poli(a)+rns-bõl vagy összes RNS-bõl a reverz-transzkriptáz enzim alkalmazásával. Két primert, amelyek jellemzõen komplementerek az (EC)hPYY 3 36 ¹ vagy a (D11C)hPYY variáns aminosavszekvenciáját kódoló cdns különálló szakaszaival, ezt követõen hozzáadunk a cdns-hez polimerázzal együtt, mint például Taq polimerázzal, és a polimeráz megsokszorozza a két primer közötti cdns szakaszt. 9

10 1 HU T2 2 Az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY variáns aminosavszekvenciáját kódoló nukleinsavmolekula elõállításának további eszköze a kémiai szintézis, amely szakember számára jól ismert eljárásokat alkalmaz, mint például azok, amelyeket Engels és munkatársai ismertettek, Angew. Chem. Intl. Ed. 28:716 34, Ezen eljárások közé tartoznak a következõk: foszfotriészter, foszforoamidit, és H¹foszfonát nukleinsav szintetizáló eljárások. Az ilyen kémiai szintézis egy elõnyös eljárása a polimer vázon történõ szintézis, amelynek során standard foszforamiditkémiát alkalmaznak. Jellemzõen az (EC)hPYY 3 36 aminosavszekvenciáját kódoló DNS körülbelül 0 nukleotid hosszúságú. A 0 nukleotidnál hosszabb nukleinsavak számos fragmensbõl szintetizálhatóak ezen módszerek alkalmazásával. A fragmensek ezt követõen összekapcsolhatóak egy (EC)hPYY gén teljes hosszúságú nukleotidszekvenciájának kialakítása végett. A polipeptid amino végét kódoló DNS fragmensnek lehet ATG¹je, ami metionint kódol. Ez a metionin vagy jelen van vagy nincs jelen az (EC)hPYY 3 36 vagy (D11C) hpyy 3 36 érett formáján, attól függõen, hogy a gazdasejtben elõállított polipeptid arra lett¹e tervezve, hogy kiválasztódjon a sejtbõl. Az izoleucint kódoló kodon szintén alkalmazható starthelyként. További, szakember által ismert eljárások szintén alkalmazhatóak. Egyes megvalósítási módokban a nukleinsavvariánsok tartalmaznak olyan kodonokat, amelyek meg lettek változtatva az (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 egy adott sejtben történõ optimális expressziójának érdekében. Az egyedi kodonváltozatok függnek az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY variánstól és az expresszióhoz választott gazdasejttõl. Ilyen kodonoptimalizálás számos módszerrel elvégezhetõ, például olyan kodonok kiválasztásával, amelyek elõnyösek erõsen expresszált génekben történõ alkalmazásra az adott gazdasejtben. Számítógépes algoritmusok, amelyek tartalmazzák a kodongyakoriság-táblázatokat alkalmazhatóak, mint például az Eco_high.Cod az erõsen expresszált bakteriális gének kodonpreferenciájára és megadja a University of Wisconsin Package Version 9.0 szoftvercsomag (Genetics Computer Group, Madison, Wis.). A további kodongyakoriságtáblázatok közé tartoznak a következõk: Celegans_high.cod, Celegans_low.cod, Drosophilahigh.cod, Human-high.cod, Maize_high.cod és Yeast_high.cod Vektorok és gazdasejtek Az (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 aminosavszekvenciáját kódoló nukleinsavmolekula megfelelõ expressziós vektorba van inszertálva standard ligálási technikák alkalmazásával. A vektort jellemzõen úgy választjuk ki, hogy mûködõképes legyen az adott alkalmazott gazdasejtben (azaz, a vektor kompatibilis a gazdasejt gépezetével, hogy a gén amplifikációja és/vagy a gén expressziója megtörténhessen). Az (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 aminosavszekvenciáját kódoló nukleinsavmolekula amplifikálható/expresszálható prokarióta, élesztõ, rovar (baculovirusrendszerek) és/vagy eukarióta gazdasejtekben. Az expressziós vektorok összefoglalását lásd Meth. Enz, 18. kötet (D. V. Goeddel, szerk., Academic Press, 1990). Jellemzõen a gazdasejtek bármelyikében alkalmazott expressziós vektorok tartalmaznak szekvenciákat a plazmid fenntartására és exogén nukleotidszekvenciák klónozására és expressziójára. Az ilyen szekvenciák, amelyeket együttesen határolószekvenciáknak nevezünk, egyes megvalósítási módok esetén jellemzõen egyet vagy többet tartalmaznak a következõ szekvenciák közül: promoter, egy vagy több enhanszer szekvencia, replikációs origó, transzkripciós terminációs szekvencia, teljes intronszekvencia, amely tartalmaz donor és akceptor vágási helyet, polipeptidkiválasztás vezetõszekvenciáját kódoló szekvencia, riboszómakötõ hely, poliadenilezési szekvencia, többszörös kapcsolószakasz az expresszálandó polipeptidet kódoló nukleinsav inszerciójára, és szelektálható jelölõelem. Ezen szekvenciák mindegyikét tárgyaljuk az alábbiakban. Adott esetben a vektor tartalmazhat tag ¹et kódoló szekvenciát, azaz olyan oligonukleotidmolekulát, amely az (EC)hPYY 3 36 vagy a (D11C)hPYY 3 36 kódolószekvencia vagy 3 végén elhelyezkedõ oligonukleotidmolekula; az oligonukleotidszekvencia polihis¹t kódol (mint például hexahis), vagy egyéb tag ¹et, mint például a FLAG, HA (hemaglutinin influenzavírus), vagy myc, amelyekre kereskedelemben elérhetõ antitestek léteznek. Ez a tag jellemzõen a polipeptidhez van fuzionálva a polipeptid expressziójakor és eszközként szolgálhat az (EC)hPYY 3 36 vagy a (D11C)hPYY 3 36 affinitástisztításához a gazdasejtbõl. Az affinitástisztítás végrehajtható például affinitás mátrixként a tag elleni antitesteket alkalmazó oszlopkromatográfia. Adott esetben a tag ezt követõen eltávolítható a tisztított (EC)hPYY 3 36 ¹ vagy (D11C)hPYY peptidtõl különbözõ eszközökkel, mint például egyes peptidázok alkalmazása hasításra, például enterokinázos emésztése FLAG tag szekvencia 3 végének, amely a SEQ ID NOs: 3 4. azonosító számokon bemutatott aminosavszekvenciák elõtt van. A határolószekvenciák lehetnek homológok (azaz, ugyanabból a fajból és/vagy törzsbõl, mint gazdasejt), heterológok (azaz, a gazdasejt fajtól vagy törzstõl különbözõ fajból), hibrid (azaz, több mint egy forrásból származó határolószekvenciák kombinációja), vagy szintetikus, vagy a határolószekvenciák lehetnek natív szekvenciák, amelyek normálisan a hpyy 3 36 expresszióját szabályozzák. A határolószekvencia forrása lehet bármilyen prokarióta vagy eukarióta élõlény, bármilyen gerinces vagy gerinctelen élõlény, vagy bármilyen növény, feltéve, hogy a határolószekvencia mûködõképes a gazdasejtben és aktiválható a gazdasejt gépezete által. Alkalmas határolószekvenciák elérhetõek a szakterületen jól ismert számos eljárás bármelyikével. Jellemzõen az itt alkalmazható szekvenciák, amelyek nem a PYY-gént határoló szekvenciák, már elõzõleg azono-

11 1 HU T sítva lettek térképezéssel és/vagy restrikciós endonukleáz általi emésztéssel, és ezáltal izolálhatóak megfelelõ szövetforrásból a megfelelõ restrikciós endonukleázok alkalmazásával. Egyes esetekben a határolószekvencia teljes nukleotidszekvenciája is ismert lehet. Ez esetben a határolószekvencia az itt ismertetett nukleinsavszintézis vagy klónozó eljárásokkal is megszintetizálható. Abban az esetben, ha a határolószekvenciának csak egy részlete ismert, akkor elõállítható a következõk alkalmazásával: PCR eljárás és/vagy szkrínelési eljárás megfelelõ oligonukleotiddal és/vagy azonos, vagy különbözõ fajból származó határolószekvenciafragmenssel genomikus könyvtárban. Ahol a határolószekvencia nem ismert, ott egy nagyobb darab DNSbõl izolálható határolószekvenciát tartalmazó DNS fragmens, ahol a nagy DNS tartalmazhat például kódolószekvenciát vagy egyéb gént vagy géneket. Az izolálás elvégezhetõ restrikciós endonukleázzal végzett emésztéssel, ami megfelelõ DNS fragmenst hoz létre, ezt követi agarózgélen végzett tisztítás alkalmazásával végzett izoláció, Qiagen oszlopkromatográfia (Chatsworth, CA), vagy egyéb szakember által ismert eljárás. Szakember számára egyértelmû az ezen célnak megfelelõ enzimek kiválasztásának módja. Egy replikációs origó jellemzõen része azoknak az expressziós vektoroknak, amelyeket kereskedelemben megvásárolhatunk, és az origó segít a vektor gazdasejtbeli amplifikációjában. Egy vektor egy bizonyos kópiaszámig történõ amplifikációja, egyes esetekben fontos lehet az (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 expressziójához. Ha a kiválasztott vektor nem tartalmaz replikációs origót, akkor kémiailag lehet egyet szintetizálni egy ismert szekvencia alapján, és ezt követõen ligálható a vektorba. Például a pbr322 (New Englang Biolabs, Beverly, MA) plazmidból származó replikációs origó megfelelõ a legtöbb Gram negatív baktériumhoz és különbözõ origók [például SV, polióma, adenovírus, vezikuláris sztomatitisz vírus (VSV), vagy papillómavírusok, mint például HPV vagy BPV] alkalmasak vektorok emlõssejtekbe történõ klónozására. Általánosan a replikációs origó nem szükséges emlõsvektorok esetében (például, az SV origót gyakran csak azért alkalmazzák, mert tartalmaz egy korai promotert). Egy transzkripciós terminációs szekvencia jellemzõen a polipeptidet kódoló szakasz 3 végén helyezkedik el, és a transzkripció befejezése a feladata. Általában, prokarióta sejtekben egy transzkripciós terminációs szekvencia G¹C gazdag fragmens, amelyet poli¹t szekvencia követ. Miközben a szekvencia könnyen klónozható egy könyvtárból vagy kereskedelemben is megvásárolható egy vektor részeként, addig könnyen meg is szintetizáltatható az itt ismertetett nukleinsavszintézis-eljárásokkal hasonló eljárásokkal. Egy szelektálható markergén elem olyan fehérjét kódol, amely szükséges a szelektív tenyésztési közegben növesztett gazdasejt növekedéséhez és túléléséhez. A jellemzõ szelekciós markergének olyan fehérjéket kódolnak, amelyek (a) rezisztenciát adnak antibiotikumokra vagy egyéb toxinokra, például ampicillin, tetraciklin, vagy kanamicin prokarióta gazdasejtek esetében; (b) a sejt auxotrófiás hiányosságait komplementálják; vagy (c) a komplex tápközegbõl nem elérhetõ kritikus tápanyagokat szolgáltatnak. Az elõnyös szelektálható marker a kanamicin rezisztencia gén, az ampicillin rezisztencia gén és a tetraciklin rezisztencia gén. Neomicin rezisztencia gén is alkalmazható szelekcióra prokarióta- és eukarióta-gazdasejtekben. Egyéb szelekciós gének is alkalmazhatóak az expresszált gén amplifikálására. Az amplifikáció egy olyan folyamat, ahol azok a gének, amelyekre nagy szükség van a növekedéshez kritikus fehérje termeléséhez, a rekombináns sejtek egymást követõ generációinak kromoszómáiban együttesen maradnak meg. Az emlõssejtek megfelelõ szelekciós markereinek példái közé tartozik a dihidrofolát reduktáz (DHFR) és a timidin kináz. Az emlõssejt transzformánsokat szelekciós nyomás alá helyezzük, ahol csak azok a transzformánsok maradnak életben, amelyek egyedileg adaptálódtak a vektorban lévõ szelekciós gén révén. A szelekciós nyomást a transzformált sejtek olyan tenyésztési közegben történõ tenyésztésével hozzuk létre, ahol a szelekciós ágens koncentrációja a tápközegben sikeresen megváltozik, ezáltal mind a szelekciós gén, mind az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY peptidet kódoló DNS amplifikációjához vezet. Ennek eredményeként nagyobb mennyiségben szintetizálódik (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 az amplifikált DNS-rõl. Egy riboszómakötõ hely általában szükséges az mrns transzlációs iniciációjához, és jellemzõ rája a Shine-Dalgarno szekvencia (prokarióták) vagy a Kozak szekvencia (eukarióták). Az elem jellemzõen a promoterhez képest 3 irányban helyezkedik el és irányban az expresszálandó (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 kódolószekvenciához képest. A Shine-Dalgarno szekvencia változó, de jellemzõen polipurin (azaz nagy az A, G tartalma). Számos Shine-Dalgarno szekvenciát azonosítottak már, amelyek mindegyike egyszerûen szintetizálható olyan módszerekkel, mint amilyeneket itt ismertettünk, és alkalmazható prokarióta vektorban. Vezetõ- vagy szignálszekvencia alkalmazható az (EC)hPYY 3 36 vagy a (D11C)hPYY 3 36 gazdasejtbõl történõ kijuttatására. Jellemzõen a szignálszekvenciát kódoló nukleotidszekvencia az (EC)hPYY 3 36 vagy a (D11C)hPYY 3 36 nukleinsavmolekula kódoló régiójába van helyezve, vagy közvetlenül az (EC)hPYY 3 36 vagy a (D11C)hPYY 3 36 kódoló régiójának végére. Számos szignálszekvenciát azonosítottak már, és a választott gazdasejtben mûködõképesek közül bármelyik alkalmazható az (EC)hPYY 3 36 vagy a (D11C)hPYY 3 36 nukleinsav-molekulához kapcsoltan. Tehát egy szignálszekvencia lehet homológ (természetben elõforduló) vagy heterológ az (EC)hPYY 3 36 vagy a (D11C)hPYY 3 36 nukleinsav-molekulához képest. Továbbá szignálszekvenciát lehet kémiai úton szintetizálni az itt ismertetett eljárások alkalmazásával. A legtöbb esetben az (EC)hPYY 3 36 vagy a 11

12 1 HU T (D11C)hPYY 3 36 gazdasejtbõl történõ szekréciója a szignálpeptid jelenléte révén a kiválasztott (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 peptidtõl elválik a szignálpeptid. A szignálszekvencia lehet a vektor része, vagy lehet része egy (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 nukleinsavmolekulának, amely a vektorba van inszertálva. A natív hpyy 3 36 szignálszekvenciát kódoló nukleotidszekvencia összekapcsolható egy (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 kódoló szakasszal vagy heterológ szignálszekvenciát kódoló nukleotidszekvencia összekapcsolható egy (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 kódoló szakasszal. A kiválasztott heterológ szignálszekvencia olyan kell, hogy legyen, amilyent felismer és feldolgoz, azaz lehasít a gazdasejt szignálpeptidáza. Azon prokarióta-gazdasejtek esetében, amelyek nem ismerik fel, vagy nem dolgozzák fel a natív hpyy szignálszekvenciát, ott a szignálszekvencia lecserélhetõ prokarióta szignálszekvenciával, amely például a következõk által alkotott csoportból választott: alkáli foszfatáz, penicillináz, vagy hõstabilis enterotoxin II vezetõszekvenciák. Az élesztõbõl történõ szekrécióhoz a natív hpyy szignálszekvencia helyettesíthetõ élesztõ invertáz, alfa faktor, vagy savas foszfatáz vezetõszekvenciájával. Emlõssejtben történõ expresszió esetén elégséges a natív szignálszekvencia, habár egyéb emlõs szignálszekvenciák is megfelelõek lehetnek. Számos esetben egy nukleinsavmolekula transzkripciója megnövekedik a vektorban lévõ egy vagy több intron révén; ez különösen igaz, ha a polipeptidet eukariótasejtben termeljük, különösen emlõs gazdasejtek esetén. Az alkalmazott intronok lehetnek a PYY génben természetesen elõforduló intronok, különösen, ha az alkalmazott gén a teljes hosszúságú genomikus szekvencia vagy annak egy fragmense. Ha az intron nem természetesen elõforduló a génben (mint a legtöbb cdns esetében), ott az intron beszerezhetõ egyéb forrásból. Az intron pozíciója a határolószekvenciák és a PYY génhez képest általában fontos, mivel az intronnak át kell lennie írva, hogy hatásos legyen. Tehát ha egy (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 kódoló cdns-molekula van átírva, akkor az intron elõnyös pozíciója a transzkripciós start helytõl 3 irányban van és a poli¹a transzkripciós terminációs szekvenciától irányban van. Elõnyösen az intron vagy intronok a cdns az egyik oldalán vagy a másikon fognak elhelyezkedni (azaz, vagy 3 ), hogy nem zavarja meg a kódolószekvenciát. Bármilyen forrásból, ideértve virális, prokarióta és eukarióta (növény vagy állat) származó bármilyen intron alkalmazható, feltéve, hogy kompatibilis a gazdasejttel, amelybe inszertálva van. Szintén ide tartoznak a szintetikus intronok. Adott esetben egy vagy több intron is alkalmazható a vektorban. Az expressziós és klónozó vektorok jellemzõen tartalmaznak egy olyan promotert, amelyet felismer a gazdaszervezet és mûködõképes módon van kapcsolva egy (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 kódolómolekulához. A promoterek át nem írt szekvenciák, amelyek irányban vannak a struktúrgén startkodonjához képest (általában 0 00 bp távolságon belül), és amelyek a struktúrgén transzkripcióját szabályozzák. A promotereket hagyományosan két osztályba soroljuk: indukálható promoterek és konstitutív promoterek. Az indukálható promoterek a szabályozásuk alatt lévõ DNS-rõl megnövekedett transzkripciót iniciálnak a tenyésztési feltételek bizonyos változása esetén, mint amilyen például egy tápanyag jelenléte vagy hiánya, vagy a hõmérsékletben történõ változás. A konstitutív promoterek másrészrõl folytonos génterméktermelést iniciálnak; azaz nincs vagy csak kis kontroll van a génexpresszión. Számos, sokféle potenciális gazdasejt által felismert promoter jól ismert. Egy megfelelõ promoter mûködõképes módon van kapcsolva egy (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 kódoló DNShez a forrás DNS-bõl restrikciós enzimes emésztéssel történõ eltávolítás és a kívánt promoterszekvencia vektorba történõ inszertálást követõen. Azonban elõnyös egy heterológ promoter, ha nagyobb transzkripciót tesz lehetõvé és az expresszált fehérje nagyobb hozamát éri el a natív promoterhez képest, és ha kompatibilis az alkalmazásra kiválasztott gazdasejt rendszerével. A prokarióta gazdákkal alkalmazható promoterek közé tartozik a béta-laktamáz és laktóz promoter rendszerek; az E. coli T7 indukálható RNS polimeráz; alkáli foszfatáz; triptofán (trp) promoter rendszer; és a hibrid promoterek, mint például tac promoter. Egyéb ismert bakteriális promoterek is megfelelõek. A szekvenciáik közölve vannak, ezáltal szakember képes a kívánt DNS-szekvenciához kapcsolni õket, szükség szerint linkerek vagy adapterek alkalmazásával, hogy bármilyen szükséges restrikciós helyet adjanak. Az élesztõgazdákkal alkalmazható megfelelõ promoterek szintén jól ismertek a technika állása szerint. Az élesztõenhanszerek elõnyösen alkalmazhatóak az élesztõpromoterekkel. Az emlõssejtekben alkalmazható megfelelõ promoterek jól ismertek és nem korlátozó módon ide tartoznak azok, amelyek vírusok genomjából erednek, mint amilyen vírus a poliómavírus, bárányhimlõvírus, adenovírus (mint például a 2¹es adenovírus), szarvasmarha-papillómavírus, szárnyas szarkómavírus, citomegalovírus, retrovírusok, hepatitisz¹b vírus és legelõnyösebben Simian vírus (SV). A további megfelelõ emlõspromoterek közé tartoznak a heterológ emlõs promoterek, például a hõsokkpromoterek és az aktinpromoter. Az (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 expresszióját szabályozó további promoterek nem korlátozó példái közé tartoznak a következõk: az SV korai promoter régió (Bemoist és Chambon, Nature 290:4, 1981); a CMV promoter; a Rous szarkóma vírus 3 hosszú terminális ismétlõdésében lévõ promoter (Yamamoto és munkatársai, Cell 22:787 97, 1980); a herpesz timidin kináz promoter (Wagner és munkatársai, Proc. Natl. Acad. Sci. U. S. A. 78:1444 4, 1981); a metalotioningén szabályozószekvenciái (Brinster és munkatársai, Nature 296:39 42, 1982); prokarióta expressziós vektorok, mint például a bétalaktamáz promoter (Villa-Kamaroff és munkatársai, Proc. Natl. Acad. Sci. U. S. A. 7: , 1978); vagy 12

13 1 HU T a tac promoter (DeBoer és munkatársai, Proc. Natl. Acad. Sci. U. S. A., 80:21 2, 1983). Egy enhanszer szekvencia inszertálható a vektorba, a magasabb rendû eukarióták transzkripciójának növelésére, ahol a DNS egy (EC)hPYY 3 36 ¹ vagy (D11C)hPYY peptidet kódol. Az enhanszerek cisz hatású DNS elemek, általában 0 bp hosszúságúak, amelyek a promoteren hatnak a transzkripció megnövelése érdekében. Az enhanszerek viszonylag irányultság- és pozíciófüggetlenek. Találtak már a transzkripciós egységhez képest és 3 irányban is. Számos emlõsgénbõl elérhetõ enhanszer szekvencia ismert (például: globin, elasztáz, albumin, alfa- fetoprotein és inzulin). Jellemzõen, azonban víruseredetû enhanszer van alkalmazva. Az SV enhanszer, a citomegalovírus korai promoter enhanszer, a polióma enhanszer, és az adenovírus enhanszerek példa enhanszer elemek eukarióta promoterek aktiválására. Miközben egy enhanszer betehetõ a vektorba az (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 kódoló nukleinsavmolekulához képest vagy 3 irányba is, addig jellemzõen a promoterhez képest irányban lévõ helyen van. Expressziós vektorok konstruálhatóak egy kiindulási vektorból, mint például egy kereskedelemben elérhetõ vektorból. Az ilyen vektorok vagy tartalmazzák, vagy nem tartalmazzák az összes szükséges határolószekvenciát. Ha az itt ismertetett határolószekvenciák közül egy vagy több még nincs benne a vektorban, akkor egyedileg beszerezhetõek és behelyezhetõek a vektorba. Szakember számára jól ismertek az egyes határolószekvenciák elõállítására szolgáló eljárások. Az elõnyös vektorok azok, amelyek kompatibilisek baktérium¹, rovar- és emlõsgazdasejtekkel. Ilyen vektorok, többek között, a következõk: pcrii, pcr3 és pcdna3.1 (Invitrogen, Carlsbad, CA), pbsii (Stratagene, La Jolla, CA), pet1 (Novagen, Madison, WI), pgex (Pharmacia Biotech, Piscataway, NJ), pegfp¹n2 (Clontech, Palo Alto, CA), petl (BlueBacII, Invitrogen), pdsr-alpha (WO 90/14363 számú nemzetközi közzétételi irat) és pfastbacdual (Gibco-BRL, Grand Island, NY). További megfelelõ vektorok nem korlátozó példái közé tartoznak kozmidok, plazmidok és módosított vírusok, de értékelhetõ módon a vektorrendszernek kompatibilisnek kell lennie a kiválasztott gazdasejttel. Az ilyen vektorok, nem korlátozó példái közé tartoznak a következõk: plazmidok, mint például Bluescript plazmid származékok (nagy kópiaszámú ColE1-alapú fágmid, Stratagene), PCR klónozó plazmidok, amelyek Taq-amplifikált PCR-termékek klónozására lettek megtervezve (például: TOPO TA Cloning Kit, PCR2.1 plazmid származékok, Invitrogen), és emlõs¹, élesztõvagy vírusvektorok, mint például a baculovírus expressziós rendszer (pbacpak plazmid származékok, Clontech). Azt követõen, hogy a vektor elõ lett állítva és az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptidet kódoló nukleinsavmolekula a vektor megfelelõ helyére lett inszertálva, a teljes vektor inszertálható egy megfelelõ gazdasejtbe amplifikálásra és/vagy polipeptidexpresszióra. Az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptid expressziós vektorjának egy kiválasztott gazdasejtbe történõ transzformációja elvégezhetõ jól ismert eljárásokkal, ideértve az olyan eljárásokat, mint például a transzformáció, infekció, elektroporáció, mikroinjektálás, lipofekció, DEAE-dextrán eljárás, vagy egyéb ismert technikák. A kiválasztott eljárás ismert szakember számára és például Sambrook és munkatársai fenti könyvében ismertetve vannak. A gazdasejtek lehetnek prokarióta-gazdasejtek (mint például az E. coli) vagy eukarióta-gazdasejtek (mint például élesztõ¹, rovar- vagy gerincessejt). A gazdasejt, ha megfelelõ körülmények között tenyésztik, akkor szintetizálja az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptidet, amely ezt követõen begyûjthetõ a tenyésztési tápközegbõl (ha a gazdasejt a tápközegbe választja ki) vagy közvetlenül az õt termelõ gazdasejtbõl (ha nem kerül kiválasztásra). A megfelelõ gazdasejt általi kiválasztás különbözõ tényezõktõl függ, mint például: kívánt expressziós szint, az aktivitáshoz szükséges vagy elõnyös polipeptidmódosítások (mint például glikozilezés vagy foszforilezés) és a biológiailag aktív formába történõ feltekeredés könnyûsége. Számos megfelelõ gazdasejt ismert a szakterületen és számos elérhetõ az American Type Culture Collection (ATCC), Manassas, VA nevû törzsgyûjteménybõl. A nem korlátozó példák közé tartoznak a következõk: kínai hörcsög petefészeksejtjei (CHO), CHO DHFR( ) sejtek (Urlaub és munkatársai, Proc. Natl. Acad. Sci. U. S. A. 97:4216, 1980), humán embrionális vese (HEK) 293 és 293T-sejtek, és 3T3 sejtek. A megfelelõ emlõsgazdasejtek szelekciója, valamint eljárások transzformálásra, tenyésztésre, amplifikációra, szkrínelésre, termék-elõállításra és tisztításra jól ismertek a szakterületen. További megfelelõ emlõssejtvonalak a majom COS¹1 és COS¹7 sejtvonalak és a CV¹1 sejtvonal. A további példa emlõsgazdasejtek közé tartoznak fõemlõssejtvonalak és rágcsálósejtvonalak, ideértve a transzformált sejtvonalakat is. Normális diploid sejtek, elsõdleges szövet in vitro tenyészetébõl származó sejtek, valamint elsõdleges explantátumok, szintén megfelelõek. A jelölt sejtek genotípusosan hiányosak lehetnek a szelekciós génre, vagy tartalmazhatnak dominánsan ható szelekciós gént. Az emlõssejtvonalak további megfelelõ, nem korlátozó példái a következõek: egér neuroblasztoma N2A sejtek, HeLa, egér L¹929 sejtek, Swiss, Balb¹c vagy NIH egerekbõl származó 3T3 vonalak, BHK vagy HaK hörcsög sejtvonalak. Ezen sejtvonalak mindegyike ismert és elérhetõ fehérjeexpresszió területén jártas szakember számára. Hasonlóan alkalmasak megfelelõ gazdasejtnek a bakteriális sejtek. Például az E. coli különbözõ törzsei (például: HB1, DHa, DH és MC61) jól ismertek, mint gazdasejtek a biotechnológia területén. A B. subtilis, Pseudomonas fajok, egyéb Bacillus fajok és Streptomyces fajok különbözõ törzsei is alkalmazhatóak ebben az eljárásban. Szakember számára ismert, számos élesztõsejt érhetõ el, mint az (EC)hPYY 3 36 ¹ és (D11C)hPYY

14 1 HU T2 2 polipeptidek expressziójának gazdasejtjei. Az elõnyös élesztõsejtek közé tartozik például a Saccharomyces cerivisae és a Pichia pastoris. Továbbá, kívánt esetben, rovarsejtrendszerek is alkalmazhatóak az (EC)hPYY 3 36 és a (D11C)hPYY 3 36 expressziójára. Ilyen rendszereket ismertetnek például a következõk: Kitts és munkatársai, 1993, Biotechniques 14:8 17; Lucklow, Curr. Opin. Biotechnol. 4:64 72, 1993; és Lucklow és munkatársai, J. Virol., 67:466 79, Az elõnyös rovarsejtek az Sf¹9 és Hi sejtek (Invitrogen). (EC)hPYY 3 36 ¹ és (D11C)hPYY polipeptid termelés Egy (EC)hPYY 3 36 és (D11C)hPYY 3 36 expressziós vektort tartalmazó gazdasejtvonal tenyészthetõ standard tápközegben, ami jól ismert szakember számára. A tápközeg általában tartalmazza a sejtek növekedéséhez és túléléséhez szükséges összes tápanyagot. Az E. coli-sejtek tenyésztéséhez megfelelõ tápközeg például a Luria Broth (LB) és/vagy Terrific Broth (TB) tápközegek. Az eukariótasejtek tenyésztéséhez megfelelõ tápközegek közé tartozik például a Roswell Park Memorial Institute tápközeg 16 (RPMI 16), Minimális Esszenciális tápközeg (MEM) és/vagy Dulbecco s Modified Eagle tápközeg (DMEM), amelyek mindegyike kiegészíthetõ szérummal és/vagy az éppen tenyésztett egyedi sejtvonalhoz szükséges növekedési faktorokkal. A rovartenyészetekre alkalmas egyik tápközeg a Grace tápközeg, szükség szerint kiegészítve élesztõkivonattal, laktalbumin hidrolizátummal és/vagy borjúszérummal. Jellemzõen a tápközeghez kiegészítõként van adva antibiotikum vagy egyéb a transzformált vagy transzfektált sejtek szelektív tenyésztését lehetõvé tevõ vegyület. Az alkalmazott vegyületet a gazdasejtet transzformált plazmidban jelen lévõ szelektálható marker elem határozza meg. Például, ahol a szelektálható marker elem a kanamicinrezisztencia, ott a tenyésztési tápközeghez adandó vegyület a kanamicin. Az egyéb szelektív tenyésztést lehetõvé tevõ vegyületek közé tartozik az ampicillin, tetraciklin és neomicin. Az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptid gazdasejt által termelt mennyisége meghatározható standard a szakterületen ismert eljárásokkal. Korlátozások nélkül, ilyen eljárások közé tartozik a Western blot vizsgálat, SDS poliakrilamid gélelektroforézis, nem denaturáló gélelektroforézis, Nagy teljesítményû folyadékkromatográfiás (HPLC) elválasztás, immunoprecipitáció, és/vagy az olyan aktivitásvizsgálatok, mint például a DNS kötõdés géleltolódás vizsgálatok. Ha az (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 úgy lett megtervezve, hogy kiválasztódjon a gazdasejtvonalból, akkor a polipeptidek legnagyobb része a sejttenyésztési tápközegben található meg. Azonban, ha a polipeptid nem választódik ki a gazdasejtekbõl, akkor a citoplazmában és/vagy sejtmagban (eukariótasejtek esetén) vagy a citoszólban (Gram negatív bakteriális gazdasejtek esetén) lesz jelen Ha egy (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptid a gazdasejt citoplazmájában és/vagy sejtmagjában (eukariótasejtek esetén) vagy a citoszóljában (Gram negatív bakteriális gazdasejtek esetén) van jelen, akkor a sejten belüli anyag (ideértve a zárványtesteket a Gram negatív baktériumok esetén) kivonható a gazdasejtbõl bármilyen szakember által ismert standard eljárással. Például a gazdasejt lizáltatható a periplazma/citoplazma tartalmának kibocsátása érdekében French press eljárással, homogénezéssel és/vagy szonikálással, amelyet centrifugálás követ. Ha az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptid zárványtesteket alakított ki a citoszólban, akkor a zárványtestek gyakran megkötõdnek a belsõ és/vagy külsõ sejtmembránokon és így a centrifugálást követõen elsõsorban a pelletanyagban lesz megtalálható. A pelletanyag ezt követõen extrém ph¹val kezelhetõ, vagy kaotrópikus ágenssel, mint például detergenssel, guanidinnel, guanidinszármazékokkal, karbamiddal, vagy karbamidszármazékokkal redukáló ágens jelenlétében, mint például ditiotreitol lúgos ph¹érték esetén vagy trisz-karboxi-etil-foszfin savas ph esetén a zárványtestek kibocsátása, feltörése és szolubilizálása érdekében. A szolubilizált (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 ezt követõen elemezhetõ gélelektroforézissel, immunoprecipitációval és hasonló eljárásokkal. Ha cél a polipeptid izolálása, akkor az izolálást elvégezhetjük standard eljárásokkal, mint amilyeneket itt ismertettünk és amilyeneket Marston és munkatársai ismertettek, Meth. Enz. 182:264 7, Ha nem alakul ki szignifikáns mennyiségû zárványtest az (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 expressziójakor, akkor a polipeptid elsõsorban a felülúszóban lesz a sejthomogenizátum centrifugálását követõen. A polipeptidet lehet tovább izolálni a felülúszóból például az itt ismertetett eljárások alkalmazásával. Az (EC)hPYY 3 36 vagy (D11C)hPYY 3 36 tisztítása oldatból különféle technikákkal érhetõ el. Ha a polipeptid oly módon lett szintetizálva, hogy tartalmaz tag¹et, mint például Hexahisztidin 9 vagy egyéb kis peptidet, mint például FLAG (Eastman Kodak Co., New Haven, CT) vagy myc (Invitrogen) akár a karboxi, akár az amino végén, akkor tisztítható egylépéses eljárással az oldatnak affinitásoszlopon történõ átáramoltatásával, ahol az oszlop mátrixának nagy affinitása van a tag-hez. Például a polihisztidin nagy affinitással és specifikussággal kötõdik nikkelhez. Tehát, egy nikkel-affinitásoszlop (mint például Qiuagen nikkeloszlop) alkalmazható a tisztításra. Lásd például Current Protocols in Molecular Biology.11.8 (Ausubel és munkatársai, kiadók: Green Publishers Inc. és Wiley and Sons, 1993). Továbbá egy (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptid tisztítható monoklonális antitest alkalmazásán keresztül, amely képes specifikusan felismerni és megkötni az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptidet. Azokban az esetekben, ahol elõnyös részlegesen vagy teljesen tisztítani az (EC)hPYY 3 36 ¹ vagy 14

15 1 HU T2 2 (D11C)hPYY polipeptidet, hogy ezáltal részlegesen vagy lényegében mentes legyen szennyezõ anyagoktól, ott szakember számára ismert standard eljárások alkalmazhatóak. Ilyen eljárások nem korlátozó példái közé tartoznak a következõk: elválasztás elektroforézissel, amelyet elektroelúció követ, különbözõ típusú kromatográfiák (affinitás, immunoaffinitás, molekuláris szûrõ és ioncsere), HPLC és preparatív izoelektromos fókuszálás ( Isoprime gép/technika, Hoefer Scientific, San Francisco, CA). Egyes esetekben két vagy több tisztítási technika kombinálható a megnövelt tisztaság elérése érdekében. Számos további eljárás ismert a szakterületen polipeptidek elõállítására és ezek az eljárások alkalmazhatóak az (EC)hPYY 3 36 ¹ és (D11C)hPYY polipeptidek elõállítására. Lásd például: Roberts és munkatársai, Proc. Natl. Acad. Sci. U. S. A. 94: , 1997, amely mrns és az általa kódolt peptid fúziósfehérjéjének elõállítását ismerteti. Lásd még: Roberts, Curr. Opin. Chem. Biol. 3:268 73, Az,763,192;,814,476;,723,323; és,817,483 számú amerikai egyesült államokbeli szabadalmak ismertetnek továbbá eljárásokat peptidek és polipeptidek elõállítására. Az eljárás tartalmazza sztochasztikus gének vagy fragmenseik termelését és ezt követõen ezen gének bejuttatását olyan gazdasejtekbe, amelyek a sztochasztikus gének által kódolt egy vagy több fehérjét termelnek. A gazdasejtek ezt követõen szkrínelve vannak azon klónok azonosítása érdekében, amelyek a kívánt aktivitású peptideket vagy polipeptideket termelik. További rekombináns peptid expressziójára szolgáló eljárásokat ismertetnek a 6,3,49, 6,2,92, 6,627,438 és 6,737, számú amerikai egyesült államokbeli szabadalmak. A folyamat E. colit és az E. coli általános kiválasztási útvonalát alkalmazza. A peptid szignálszekvenciához van fuzionálva, tehát a peptid kiválasztásra van célozva. További eljárást ismertet a WO 99/1 számú nemzetközi közzétételi irat peptidek vagy polipeptidek elõállítására. A közölt eljárás, amelyet gének felfedezése céljából végzett véletlen génexpresszió-aktiválásnak neveznek, tartalmazza endogén génexpresszió aktiválását vagy egy gén túltermelését in situ rekombinációs eljárásokkal. Például egy endogén gén expressziója aktiválódik vagy megnövekedik a célsejtbe történõ szabályozószekvencia integrálásával, amely célsejt képes a gén expressziójának aktiválására nem homológ vagy rendellenes rekombinációval. A cél DNS¹t elõször sugárzásnak vetik alá, és ezt követõen inszertálódik a genetikai promoter. A promoter végül a gén elõtt lévõ törésbe lokalizálódik, kiváltva ezzel a gén transzkripcióját. Ez a kívánt peptid vagy polipeptid expresszióját eredményezi. Amidálás Szintetikusan vagy rekombinánsan elõállított peptid amidálása elvégezhetõ egy peptidil-glicin-alfa amidáló monooxigenáz (PAM) nevû enzimmel. Az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY peptidek rekombináns elõállítása során, bakteriális expressziós rendszer alkalmazásakor, a peptidek lehetnek C¹terminálisan amidáltak in vitro reakcióval rekombináns PAM enzim alkalmazásával. A PAM enzim forrás, eljárások az elõállítására és tisztítására, és az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY peptidek amidálására alkalmazható eljárásokat ismertetnek a 4,708,934;,789,234 és 6,319,68 számú amerikai egyesült államokbeli szabadalmak. Szelektív (EC)hPYY 3 36 és (D11C)hPYY 3 36 antitestek Az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptidekhez, amelyek pegezve vannak vagy nincsenek pegezve a cisztein szubsztitúció helyén (amint azt itt ismertetjük), specifikusan kötõdõ antitestek és antitest fragmensek, amelyek nem kötõdnek szelektíven a natív hpyy3 36-hoz, a találmány oltalmi körén belül vannak. Az antitestek lehetnek poliklonálisak, ideértve a monospecifikus poliklonálist; monoklonálisak; rekombinánsak; kiméra; humanizált, mint például CDR-graftolt; humán; egyláncú; és/vagy bispecifikusak; valamint fragmensek; variánsok; vagy ezek származékai. Az antitest fragmensek közé tartoznak azok az antitestrészek, amelyek egy epitóphoz kötõdnek az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptideken. Ilyen fragmensek példái közé tartoznak a teljes antitestek enzimatikus hasításával létrehozott Fab és F(ab ) fragmensek. A további kötõfragmensek közé tartoznak azok, amelyek rekombináns DNS-technikákkal lettek elõállítva, mint például antitest variábilis szakaszokat kódoló nukleinsavszekvenciákat tartalmazó rekombináns plazmidok expressziója. Az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptidre irányított poliklonális antitesteket általánosan állatokban állítják elõ (például nyulakban vagy egerekben) többszörös az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptid és egy adjuváns többszörös SC vagy IP injekciójával. Elõnyös lehet az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptidet hordozófehérjéhez konjugálni, amely immunogén az immunizált fajban, mint például a kulcslyuk limpet hemocianin, szérum albumin, szarvasmarha tiroglobulin, vagy szójabab tripszin inhibitor. Továbbá aggregáló ágensek, mint például az alum alkalmazható az immunválasz serkentésére. Az immunizálási követõen az állatokat kivéreztetik és a szérumot vizsgáljuk (EC)hPYY 3 36 elleni vagy (D11C)hPYY 3 36 elleni antitest titerre. Az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptidek elleni monoklonális antitestek elõállíthatóak bármilyen eljárással, amely tenyészetben folytonos sejtvonalak által termelt antitestmolekulákat biztosít. A megfelelõ monoklonális antitestek elõállítására szolgáló eljárások példái közé tartoznak Kohler és munkatársai, Nature 26:49 97, 197 hibridomaeljárásai, és a humán B¹cell hibridomaeljárás (Kozbor, J. Immunol. 133:01, 1984; Brodeur és munkatársai, Monoclonal Antibody Production Techniques and Applications, 1 63 (Marcel Dekker, Inc., 1987). A találmány ad továbbá hibridoma-sejtvonalakat, amelyek (EC)hPYY 3 36 ¹ vagy (D11C)hPYY

16 1 HU T2 2 polipeptidekkel reaktív monoklonális antitesteket termelnek. A kompetitív inhibíció révén meghatározott monoklonális antitestspecifikusság és affinitás elõnyös eljárásai megtalálható: Harlow és Lane, Antibodies: A Laboratory Manual (Cold Spring Harbor Laboratories, 1989); Current Protocols in Immunology (Colligan és munkatársai, kiadó: Greene Publishing Assoc. és Wiley Interscience, 1993); és Muller, Meth. Enzymol. 92:89 1, A találmány szerinti kiméra antitestek tartalmazhatnak egyedi H és/vagy L immunoglobulin láncokat. Egy elõnyös kiméra H lánc tartalmaz antigénkötõhelyet, ami nem humán antitest H láncából ered, amely antitest specifikus egy (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptidre, amely kapcsolva van legalább a humán H lánc C régiójának (C H ) legalább egy részéhez, mint például CH 1 vagy CH 2. Egy elõnyös kiméra L lánc tartalmaz L lánc eredetû antigénkötõ régiót, amely L lánc (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptidre specifikus nem humán antitest, amely polipeptid a humán L lánc C régiójának (C L ) legalább egy részletéhez van kötve. A szakterületen ismertek a kiméra antitestek és az elõállításukra szolgáló eljárások. Lásd Cabilly és munkatársai, Proc. Natl. Acad. Sci. U. S. A. 81: , 1984; Morrison és munkatársai, Proc. Natl. Acad. Sci. U. S. A. 81:681, 1984; Boulianne és munkatársai, Nature 312:643 46, 1984; Neuberger és munkatársai, Nature 314:268 70, 198; Liu és munkatársai, Proc. Natl. Acad. Sci. U. S. A. 84: , 1987; és Harlow és Lane, fent. Ugyanazon vagy különbözõ kötésspecifitású kiméra H láncokat és L láncokat kötõ szelektív kötõágensek szintén elõállíthatóak az egyedi polipeptidláncok megfelelõ társításával, a szakterületen ismert eljárásokkal. Lásd például: Current Protocols in Molecular Biology (Ausubel és munkatársai, kiadó: Green Publishers Inc. és Wiley and Sons, 1994) és Harlow és Lane, fent. Ezen megközelítés szerint kiméra H láncokat (vagy származékaikat) expresszáló gazdasejtek, és az immunglobulinláncok különállóan vannak kinyerve, majd ezt követõen társítva. Alternatív esetben a gazdasejtek együttesen tenyészthetõk és a láncokat spontán módon hagyjuk asszociálni a tenyésztési tápközegben, és ezt követõen kinyerjük az elkészült immunglobulint. Egy további megvalósítási mód szerint a találmány szerinti monoklonális antitest humanizált antitest. A szakterületen jól ismertek a nem humán antitestek humanizálására szolgáló eljárások. Lásd,8,089 és,693,762 számú amerikai egyesült államokbeli szabadalmak. Általában egy humanizált antitestbe egy vagy több aminosav van bevive egy nem humán forrásból. A humanizálás elvégezhetõ például a szakterületen ismert eljárásokkal (Jones és munkatársai, 1986, Nature 321:22 2; Riechmann és munkatársai, 1998, Nature 332:323 27; Verhoeyen és munkatársai, 1988, Science 239:134 36), a rágcsáló komplementaritást meghatározó régió (CDR) legalább egy részének humán antitest megfelelõ részére történõ helyettesítésével Antitest-molekulák (azaz, Fab vagy variábilis régió fragmensek) antigénkötõ régióinak rekombináns DNS változatait létrehozó technikák, amelyek kikerülik a monoklonális antitestek létrehozását, szintén a találmány oltalmi körén belül vannak. Ebben a technikában, antitestspecifikus hírvivõ RNS-molekulák vannak kivonva az immunrendszer sejtjeibõl, amelyek immunizált állatból származnak és cdns¹be vannak átírva. A cdns ezt követõen bakteriális expressziós rendszerbe van klónozva. Az ilyen technikák egy példája, amely megfelelõ jelen találmány gyakorlatba vételére, egy bakteriofág lambda vektor rendszert alkalmaz, amelyben olyan vezetõszekvencia van, amely az expresszált Fab fehérjét a periplazmás térbe irányítja (a bakteriális sejtmembrán és a sejtfal közé) vagy kiválasztásra. Könnyen elõállítható és szkrínelhetõ nagyszámú funkcionális Fab fragmens azokra, amelyek kötik az antigént. Ilyen (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptidet kötõ molekulák [Fab fragmensek, amelyek specifikusak az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptidre] specifikusan részét képezik az antitest kifejezésnek a leírás szerinti értelemben. Szintén a találmány oltalmi körén belül vannak technikák, amelyeket kiméra antitestek elõállítására fejlesztettek ki megfelelõ antigénspecifitású egérantitest-molekula génjeinek hasítása egyidejûleg megfelelõ biológiai aktivitású [mint például humán komplement aktiválási képesség és antitestfüggõ celluláris citotoxikusság (ADCC) közvetítõ képesség] humán antitestmolekula génjeivel. Morrison és munkatársai, Proc. Natl. Acad. Sci. U. S. A. 81:681, 1984; Neuberger és munkatársai, Nature, 312:4 08, Az ezzel a technikával elõállított szelektív kötõágensek, mint például antitestek szintén a találmány oltalmi körén belül vannak. Értelemszerûen a találmány nem korlátozódik egér vagy patkány monoklonális antitestekre; valójában humán antitestek is alkalmazhatóak. Ilyen antitestek elõállíthatóak humán hibridomák alkalmazásával. A teljesen humán antitestek, amelyek megkötik a (EC)hPVV 3 36 ¹ vagy (D11C)hPYY polipeptideket, tehát a találmány részét képezik. Ilyen antitesteket állíthatunk elõ transzgenikus állatok (például egerek) (EC)hPYY 3 36 ¹ vagy (D11C)hPYY antigénnel történõ immunizálással (adott esetben hordozóhoz konjugálva), amely egerek képesek endogén immunglobulintermelés hiányában humán antitestrepertoár elõállítására. Lásd például: Jakobovits és munkatársai, Proc. Natl. Acad. Sci. U. S. A. 90:21, 1993; Jakobovits és munkatársai, Nature 362:2 8, 1993; Bruggemann és munkatársai, Year in Immuno. 7:33, A találmány magában foglal olyan humán antitesteket is, amelyek kötõdnek az (EC)hPYY 3 36 ¹ vagy (D11C)hPYY polipeptidekhez. Transzgenikus állatok (például egerek) alkalmazásával, amelyek endogén immunglobulintermelés hiányában képesek humán antitestek repertoárjának termelésére, ilyen antitesteket (EC)hPYY 3 36 ¹ vagy (D11C)hPVV polipeptid antigénnel történõ immunizálással állítunk elõ (azaz leg- 16

17 1 HU T alább 6 folytonos aminosavval bír), adott esetben hordozóhoz konjugáltan. Lásd például: Jakobovits és munkatársai, 1993 fent; Jakobovits és munkatársai, Nature 362:2 8, 1993; Bruggermann és munkatársai, 1993, fent. Egy eljárás szerint ilyen transzgenikus állatokat állítunk elõ a benne a nehéz és könnyû immunglobulinláncokat kódoló lókuszok inaktiválásával, és a genomjukba humán nehéz- és könnyûlánc fehérjéket kódoló lókuszok inszertálásával. Részlegesen módosított állatok, azaz, amelyek kevesebb mint a teljes módosítással komplement bírnak, ezt követõen keresztezve vannak, hogy olyan állatot kapjunk, amelynek a kívánt, módosított immunrendszere van. Ha ezen transzgenikus állatoknak immunogént adunk, akkor ezek az állatok humán aminosavszekvenciájú (nem pedig például rágcsáló¹) antitesteket termelnek, ideértve az ezen antigénekre immunspecifikus variábilis régiókat is. Lásd: WO 96/3373 és WO 94/022 számú nemzetközi közzétételi irat. További eljárásokat ismertetnek:,4,807 számú amerikai egyesült államokbeli szabadalom, WO 91/741 és WO 90/036 számú nemzetközi közzétételi iratok, és B1 számú európai szabadalom és WO 92/03918 számú nemzetközi közzétételi irat. Humán antitestek szintén elõállíthatóak gazdasejtekben történõ rekombináns DNS expresszióval vagy hibridomasejtekben történõ expresszióval, amint azt itt ismertettük. Egy alternatív megvalósítási mód szerint humán antitestek elõállíthatóak fág-bemutatott könyvtárakból is Hoogenboom és munkatársai, J. Mol. Biol. 227:381, 1991; Marks és munkatársai, J. Mol. Biol. 222:81, 1991). Ezek az eljárások utánozzák az immunszelekciót antitestrepertoárok bemutatása révén filamentumos bakteriofág felszínén, és a fág ezt követõ szelekcióját a kiválasztott antigénhez történõ kötõdés révén. Egy ilyen technikát ismertettek a WO 99/494 számú nemzetközi közzétételi iratban, amely nagy affinitású és funkcionálisan agonisztikus antitestek izolálását ismerteti MPL- és msk-receptorokra ilyen megközelítés alkalmazásával. A kiméra, CDR ojtott, és humanizált antitesteket jellemzõen rekombináns eljárásokkal állítják elõ. Az antitesteket kódoló nukleinsavak vannak bejuttatva gazdasejtekbe és expresszálva vannak az itt ismertetett és a technika állasa szerinti anyagok és eljárások alkalmazásával. Egy elõnyös megvalósítási mód szerint az antitestek emlõsgazdasejtben, mint például CHO sejtekben vannak elõállítva. Monoklonális (például humán) antitestek elõállíthatóak gazdasejtben rekombináns DNS expresszálásával vagy hibridomasejtekben történõ expresszióval, ahogy ezt ismertettük. A találmány szerinti anti-(ec)hpyy 3 36 és anti- (D11C)hPYY 3 36 antitestek alkalmazhatóak bármilyen ismert vizsgálati módszerben, mint például kompetitív kötõdési vizsgálatok, közvetlen és közvetett szendvics vizsgálatok és immunprecipitációs vizsgálatok [Sola, Monoclonal Antibodies: A Manual of Techniques, (CRC Press, Inc., 1987)] az (EC)hPYY 3 36 ¹ és (D11C)hPYY polipeptidek detektálására és mennyiségi meghatározására, valamint polipeptidtisztításra. Az antitestek olyan affinitással kötõdnek az (EC)hPVV 3 36 ¹ vagy (D11C)hPYY polipeptidek, amely megfelelõ az alkalmazott vizsgálati eljáráshoz. A találmány szerinti PYY agonisták adhatóak gyógyászatilag alkalmazható savaddíciós só formájában a találmány szerinti eljárásban történõ alkalmazáshoz. Jellemzõ gyógyászatilag elfogadható savaddíciós sói a találmány szerinti vegyületeknek például a következõk: hidroklorid¹, hidrobromid¹, hidrojodid¹, nitrát¹, szulfát¹, biszulfát¹, foszfát¹, savanyú foszfát¹, izonikotinát¹, acetát¹, laktát¹, szalicilát¹, citrát¹, savanyú citrát¹, tartarát¹, pantotenát¹, bitartarát¹, aszkorbát¹, szukcinát¹, maleát¹, gantizinát¹, fumarát¹, glükonát¹, glükuronát¹, szaccharát¹, formiát¹, benzoát¹, glutamát¹, metánszulfonát¹, etánszulfonát¹, benzolszulfonát¹, pozícióig tartó toluolszulfonát¹, pamoát¹, palmitát¹, malonát¹, sztearát¹, laurát¹, malát¹, borát¹, hexafluor-foszfát¹, naftilát¹, glükoheptanoát¹, laktobionát és lauril-szulfonát-sók és a hasonlók. A nem pegezett változatok sói nem szükséges, hogy gyógyászatilag elfogadhatóak legyenek, ha az alkalmazott változat egy köztitermék a PEG-PYY 3 36 változat konjugátum elõállítása során. A találmány szerinti PYY agonisták általában gyógyászati készítmény formában vannak beadva. A gyógyászati készítmény lehet például orális beadásra (például tabletta, kapszula, pirula, por, oldat, szuszpenzió), parenterális injekcióra (például steril oldat, szuszpenzió vagy emulzió), intranazális beadásra (például aeroszol cseppek stb.), rektális beadásra (például kúp) vagy transzdermális beadásra (például tapasz) alkalmas formában. A gyógyászati készítmény tartalmazni fog hagyományos gyógyászati hordozót és hatóanyagként a találmány szerinti PYY agonistát. Továbbá tartalmazhat további hatóanyagokat, adjuvánsokat stb. is. Bioaktív peptidek különbözõ gyógyászati készítményeinek elõállítására szolgáló eljárások jól ismertek a gyógyszerészetben. Lásd például a 0/ számú (az orális beadásra); és 04/017777, 0/ és 0/02147 számú amerikai egyesült államokbeli szabadalmi bejelentéseket (nyálkahártyán keresztüli beadásra, például intranazális vagy bukkális beadás). Lásd még Remington: The Practice of Pharmacy, Lippincott Williams and Wilkins, Baltimore, MD,. kiadás 00. A találmány szerinti PYY agonista alkalmazható egyéb gyógyászati hatóanyagokkal az itt ismertetett betegségállapotok és ¹körülmények kezelésére. Tehát a kezelési eljárások tartalmazzák a találmány szerinti vegyületek beadását kombinációban egyéb hatóanyagokkal és szintén a találmány tárgyát képezik. A találmány szerinti PYY agonistákkal kombinációban alkalmazható gyógyászati hatóanyagok közé tartoznak elhízás elleni hatóanyagok, mint például kannabinoid¹1 (CB¹1) antagonisák (mint például rimonabant), 11 -hidroxi-szteroid-dehidrogenáz¹1 (1¹es típusú 11 - HSD) inhibitorok, MCR¹4 agonisták, kolecisztokinin¹a (CCK¹A) agonisták, monoamin újrafelvétel gátlók (mint például szibutramin), szimpatomimetikus ágensek, 3 - adrenerg receptor agonisták, dopamin receptor agonisták (mint például bromocriptin), melanocitastimuláló 17

18 1 HU T hormon receptor analógok, HT2c receptor agonisták, melaninkoncentráló hormon antagonisták, leptin, leptin analógok, leptin receptor agonisták, galanin antagonisták, lipáz inhibitorok (mint például tetrahidrolipsztatin, például orlisztát), anorektikus ágensek (mint például a bombezin agonista), neuropeptid¹y receptor antagonisták (például NPY Y receptor antagonisták), tiromimetikus ágensek, dehidroepiandroszteron vagy analógja, glükokortikoid receptor agonisták vagy antagonisták, orexin receptor antagonisták, glükagonszerû peptid¹1 receptor agonisták, ciliáris neurotrófikus faktorok (mint például Axokine beszerezhetõ: Regeneron Pharmaceuticals, Inc., Tarrytown, NY és Procter & Gamble Company, Cincinnati, OH), humán agutirokon protein (AGRP) inhibitorok, ghrelin receptor antagonisták, hisztamin 3 receptor antagonisták vagy inverz agonisták, neuromedin U receptor agonisták, MTP/ApoB inhibitorok (például nyelõcsõszelektív MTP inhibitorok, mint például dirlotapid) és a hasonlók. A találmány szerinti PYY agonistákkal kombinációban alkalmazható elõnyös elhízás elleni hatóanyagok közé tartoznak a következõk: CB¹1 receptor antagonisták, nyelõcsõszelektív MTP inhibitorok, CCKa agonisták, HT2c receptor agonisták, NPY Y receptor antagonisták, orlisztát és szibutramin. A találmány szerinti eljárásokban alkalmazható elõnyös CB¹1 receptor antagonisták közé tartoznak a következõk: rimonabant (SR141716A ismert az Acomplia márkanéven is) beszerezhetõ a Sanofi-Synthelabo-tól vagy elõállítható az,624,941 számú amerikai egyesült államokbeli szabadalomban ismertetett módon; N¹(piperidin-1¹il)-1¹(2,4- diklór-fenil)--(4¹jód-fenil)-4-metil-1h-pirazol-3- karboxamid (AM21) beszerezhetõ a Tocris -tól, Ellisville, MO; [¹(4¹bróm-fenil)-1¹(2,4-diklór-fenil)-4-etil-N- (1¹piperidinil)-1H-pirazol-3-karboxamid) (SR147778), amely elõállítható a 6,64,98 számú amerikai egyesült államokbeli szabadalomban ismertetett módon; N¹(piperidin-1¹il)-4,-difenil-1-metil-imidazol-2-karboxamid, N¹(piperidin-1¹il)-4¹(2,4-diklór-fenil)--(4¹klór-fenil)-1- metil-imidazol-2-karboxamid, N¹(piperidin-1¹il)-4,-di- (4¹metil-fenil)-1-metil-imidazol-2-karboxamid, N¹ciklo- hexil-4,-di-(4¹metil-fenil)-1-metil-imidazol-2- karboxamid, N¹(ciklohexil)-4¹(2,4-diklór-fenil)--(4¹klórfenil)-1-metil-imidazol-2-karboxamid és N¹(fenil)-4¹(2,4- diklór-fenil)--(4¹klór-fenil)-1-metil-imidazol-2- karboxamid, amely elõállítható a WO 03/076 számú nemzetközi közzétételi iratban ismertetett módon; az 1¹[9¹(4¹klór-fenil)-8-(2¹klór-fenil)-9H-purin-6¹il]-4-etilamino-piperidin-4-karbonsavamid-hidroklorid, mezilát és bezilát sója, amely elõállítható a 04/0092 számú amerikai egyesült államokbeli szabadalmi bejelentésben ismertetettek szerint; 1¹[7¹(2¹klór-fenil)-8-(4¹klórfenil)-2-metil-pirazolo[1,¹a][1,3,]triazin-4¹il]-3-etil-amino-azetidin-3-karbonsavamid és 1¹[7¹(2¹klór-fenil)-8- (4¹klór-fenil)-2-metil-pirazolo[1,¹a][1,3,]triazin-4¹il]-3- metil-amino-azetidin-3-karbonsavamid, amely elõállítható a 04/ számú amerikai egyesült államokbeli szabadalmi bejelentésben ismertetettek szerint; 3¹(4¹klór-fenil)-2-(2¹klór-fenil)-6¹(2,2-difluor-propil)- 2,4,,6-tetrahidro-pirazolo[3,4¹c]piridin-7¹on, amely elõállítható a 04/02148 számú amerikai egyesült államokbeli szabadalmi bejelentésben ismertetettek szerint; 3¹(4¹klór-fenil)-2-(2¹klór-fenil)-7¹(2,2-difluor-propil)- 6,7-dihidro¹2H,H-4-oxa-1,2,7-triazaazulén-8¹on, amely elõállítható a 0/0192 számú amerikai egyesült államokbeli szabadalmi bejelentésben ismertetettek szerint; 2¹(2¹klór-fenil)-6¹(2,2,2-trifluor-etil)-3- (4¹trifluor-metil-fenil)-2,6-dihidropirazolo[4,3¹d]pirimidin- 7¹on, amely elõállítható a 04/ számú amerikai egyesült államokbeli szabadalmi bejelentésben ismertetettek szerint; (S)-4-klór-N-{[3¹(4¹klór-fenil)-4-fenil-4,-dihidropirazol-1¹il]-metil-amino-metilén}-benzolszulfonamid (SLV-319) és (S)-N-{[3¹(4¹klór-fenil)-4-fenil-4,-dihidropirazol-1¹il]-metil-amino-metilén}-4-trifluor-metil-benzolszulfonamid (SLV-326), amely elõállítható a WO 02/ számú nemzetközi közzétételi iratban ismertetettek szerint; N¹piperidino--(4¹bróm-fenil)-1¹(2,4-diklór-fenil)-4-etil-pirazol-3-karboxamid, amely elõállítható a 6,432,984 számú amerikai egyesült államokbeli szabadalomban ismertetettek szerint; 1¹[bisz-(4¹klór-fenil)-metil]-3-[(3,-difluor-fenil)- metánszulfonil-metilén]-azetidin, amely elõállítható a 6,18,264 számú amerikai egyesült államokbeli szabadalomban ismertetettek szerint; 2¹(¹(trifluor-metil)-piri- din-2-il-oxi)-n-(4¹(4¹klór-fenil)-3-(3¹ciano-fenil)-butan- 2¹il)-2-metil-propanamid, amely elõállítható a WO 04/ számú nemzetközi közzétételi iratban ismertetettek szerint; 4¹{[6¹metoxi-2-(4¹metoxi-fenil)-1- benzofuran-3¹il]-karbonil}-benzonitril (LY-313), amely elõállítható az,747,24 számú amerikai egyesült államokbeli szabadalomban ismertetettek szerint; 1¹[2¹(2,4-diklór-fenil)-2-(4¹fluor-fenil)-benzo[1,3]dioxol--szulfonil]-piperidin, amely elõállítható a WO 04/0131 számú nemzetközi közzétételi iratban ismertetettek szerint; és [3¹amino--(4¹klór-fenil)-6¹(2,4- diklór-fenil)-furo[2,3¹b]piridin-2¹il]-fenil-metanon, amely elõállítható a WO 04/ számú nemzetközi közzétételi iratban ismertetettek szerint. A találmány szerinti kombinációkban, gyógyászati készítményekben, eljárásokban alkalmazható elõnyös belekben ható MTP inhibitorok közé tartoznak a következõk: dirlotapid ((S)-N-{2¹[benzil-(metil)-amino]-2-oxo- 1-fenil-etil}-1-metil)--{4 -(trifluor-metil)¹[1,1 -bifenil)]-2- karboxamido]-1h-indol-2-karboxamid) és 1¹metil)-- [(4 -trifluor-metil-bifenil-2-karbonil)-amino]-1h-indol-2- karbonsav-(karbamoil-fenil-metil)-amid, amelyek mindegyike elõállítható a 6,7,31 számú amerikai egyesült államokbeli szabadalomban ismertettek szerint; (S)-2-[(4 -trifluor-metil-bifenil-2-karbonil)-amino]-kinolin-6-karbonsav-(pentil-karbamoil-fenil-metil)-amid, (S)- 2-[(4 -terc-butil-bifenil-2-karbonil)-amino]-kinolin-6-kar- bonsav-([(4¹fluor-benzil)-metil-karbamoil)-fenil-metil}- amid, és (S)-2-[(4 -terc-butil-bifenil-2-karbonil)-amino]- kinolin-6-karbonsav-[(4¹fluor-benzil-karbamoil)-fenilmetil]-amid, amelyek mindegyike elõállítható a 0/02399A1 számú amerikai egyesült államokbeli szabadalmi bejelentésben ismertettek szerint, ( )-4- [4¹(4¹[4¹[[(2S,4R)-2-(4¹klór-fenil)-2-[[(4¹metil-4H-1,2,4- triazol-3¹il)-szulfanil]-metil-1,3-dioxolán-4¹il]-metoxi]-fe- nil]-piperazin-1¹il]-fenil]-2-(1r)-1-metil-propil]-2,4-dihid- 18

19 1 HU T2 2 ro-3h-1,2,4-triazol-3¹on (ismert, mint Mitratapid vagy R377), amely elõállítható az,21,186 és,929,07 számú amerikai egyesült államokbeli szabadalmakban ismertetett módon; és implitapid (BAY ), amely elõállítható a 6,26,431 számú amerikai egyesült államokbeli szabadalomban ismertetett módon. A legelõnyösebb a dirlotapid, mitratapid, (S)-2- [(4 -trifluor-metil-bifenil-2-karbonil)-amino]-kinolin-6- karbonsav-(pentil-karbamoil-fenil-metil)-amid, (S)-2- [(4¹terc-butil-bifenil-2-karbonil)-amino]-kinolin-6-kar- bonsav-{[(4¹fluor-benzil)-metil-karbamoil]-fenil-metil}- amid, vagy (S)-2-[(4 -terc-butil-bifenil-2-karbonil)-ami- no]-kinolin-6-karbonsav-[(4¹fluor-benzil-karbamoil)- fenil-metil]-amid. Az elõnyös NPY Y receptor antagonisák közé tartoznak a következõk: 2¹oxo-N-(¹fenil-pirazinil)-spiro[izobenzofurán-1-(3H),4 -piperidin]-1 -karboxamid, amely elõállítható a 02/01146 számú amerikai egyesült államokbeli szabadalmi bejelentésben ismertetettek szerint; és 3¹oxo-N-(¹fenil-2-pirazinil)-spiro[izobenzofurán-1-(3H),4 -piperidin]-1 -karboxamid; 3¹oxo-N-(7¹trifluor-metil-pirido[3,2¹b]piridin-2¹il)- spiro[izobenzofurán-1-(3h),4 -piperidin]-1 -karboxamid; N¹[¹(3¹fluor-fenil)-2-pirimidinil]-3-oxospiro-[izobenzofurán-1-(3H)], [4 -piperidin]-1 -karboxamid; transz-3 - oxo-n-(¹fenil-2-pirimidinil)]-spiro[ciklohexán-1,1 - (3 H)-izobenzofurán]-4-karboxamid; transz-3 -oxo-n- [1¹(3¹kinolil)-4-imidazolil]-spiro[ciklohexán-1,1 -(3 H)- izobenzofurán]-4-karboxamid; transz-3-oxo-n-(¹fenil- 2-pirazinil)-spiro-[4¹azaizo-benzofurán-1-(3H),1 -ciklohexán]-4 -karboxamid; transz-n-[¹(3¹fluor-fenil)-2-pirimidinil]-3-oxospiro-[¹azaizobenzofurán-1-(3h),1 -ciklohexán]-4 -karboxamid; transz-n-[¹(2¹fluor-fenil)-2-pirimidinil]-3-oxospiro-[¹azaizobenzofurán-1-(3h),1 -ciklohexán]-4 -karboxamid; transz-n-[1¹(3,-difluor-fenil)- 4-imidazolil]-3-oxospiro-[7¹azaizobenzourán-1-(3H),1 - ciklohexán]-4 -karboxamid; transz-3-oxo-n-(1¹fenil-4- pirazolil)-spiro-[4¹azaizobenzofurán-1-(3h),1 -ciklohexán]-4 -karboxamid; transz-n-[1¹(2¹fluor-fenil)-3-pirazolil]-3-oxospiro-[6¹azaizobenzofurán-1-(3h),1 -ciklohexán]-4 -karboxamid; transz-3-oxo-n-(1¹fenil-3-pirazo- lil)-spiro-[6¹azaizobenzofurán-1-(3h),1 -ciklohexán]-4 - karboxamid; és transz-3-oxo-n-(2¹fenil-1,2,3-triazol- 4¹il)-spiro-[6¹azaizobenzofurán-1-(3H),1 -ciklohexán]- 4 -karboxamid, amelyek mindegyike elõállítható a WO 03/ számú nemzetközi közzétételi iratban ismertetettek szerint; és gyógyászatilag elfogadható sóik és észtereik. A találmány szerinti eljárásokban a találmány szerinti PYY agonista önmagában vagy egy vagy több gyógyászati hatóanyaggal kombináltan periferiálisan van beadva alanynak külön vagy együtt bármilyen a szakterületen ismert periferiális beadási módon. Tehát, a PYY agonista vagy kombináció beadható alanynak parenterálisan (például intravénásan, intraperitoneálisan, intramuszkulárisan vagy szubkután), intranazálisan, orálisan, nyelv alatti módon, bukkálisan inhalációval (például aeroszollal), rektálisan (például kúpokkal) vagy transzdermálisan. A parenterális beadás az elõnyös beadási eljárás, és a parenterális beadás elõnyös beadási módja a szubkután beadás A parenterális injekciós beadásra alkalmas készítmények általában tartalmaznak gyógyászatilag elfogadható steril vizes vagy nem vizes oldatokat, diszperziókat, szuszpenziókat vagy emulziókat, és steril injekciózható oldatokká vagy diszperziókká újraoldható steril porokat. A megfelelõ vizes és nem vizes hordozók és diluensek (ideértve oldószereket és hordozókat) közé tartoznak a következõk: víz, etanol, poliolok (propilénglikol, polietilénglikol, glicerin és a hasonlók), ezek megfelelõ keverékei, trigliceridek, ideértve a növényi olajokat, mint például olívaolaj, és injekciózható szerves észterek, mint például az etil-oleát. Ezek a parenterális injekciózásra szolgáló készítmények tartalmazhatnak excipienseket is, mint például tartósító¹, nedvesítõ¹, szolubilizáló¹, emulgeáló- és diszpergálószereket. A készítmények mikroorganizmusok általi fertõzésének megelõzése elérhetõ különbözõ antibakteriális és gomba elleni szerekkel, például parabének, klór-butanol, fenol, szorbinsav és a hasonlók. Elõnyös lehet az is, hogy tartalmaz izotóniás szereket, például cukrokat, nátrium-kloridot és a hasonlókat. Az injekciózható gyógyászati készítmények elnyújtott abszorpciója elérhetõ olyan szerek alkalmazásával, amelyek képesek az abszorpció késleltetésére, például alumínium-monosztearát és zselatin. A találmány szerinti PYY agonisták alanynak olyan dózisban lesznek beadva, ami számos tényezõtõl függ, ideértve a beadás módját, az alany korát és súlyát, a betegség súlyosságát, a kezelt állapotot vagy rendellenességet, és a beadott PYY agonista farmakológiai aktivitását. A dózistartományok és az optimális dózisok meghatározása egy adott páciens esetében bõven az átlagos képességû szakember tudásán belül van. Parenterális beadás esetén a találmány szerinti PYY agonista beadható humán alanynak körülbelül 0,01 g/kg körülbelül mg/kg/dózistartományba esõ dózisokban nem pegezett változatot alapul vevõ dózisrezsimben. Például a K mpeg-maleimid (EC)hPYY 3 36 esetén a parenterális dózisszint a körülbelül 0,01 g/kg körülbelül mg/kg/dózis dózistartományba esne az (EC)hPYY 3 36 alapján, elõnyösen a körülbelül 0,0 mg/kg körülbelül 1,0 mg/kg/dózis tartományba, vagy körülbelül 0,0 vagy 0,1 mg/kg körülbelül 1,0 mg/kg/dózis, vagy körülbelül 0,0 vagy 0,1 mg/kg körülbelül 0,3 vagy 0, mg/kg/dózis. Például 8 mg K mpeg-maleimid (EC)hPYY 3 36 dózis, amelynek a molekulatömege körülbelül Da ( k Da PEG plusz 24, a nem pegezett peptid molekulatömege), ekvivalens mg nem pegezett (EC)hPYY alapúval. A dózisrezsim lehet napi egy vagy több dózis, elõnyösen étkezések elõtt, vagy különösen a K mpeg-maleimid (EC)hPYY 3 36 vagy a K mpeg-maleimid (EC)hPYY 3 36 esetén elõnyös a heti kétszer vagy háromszor vagy heti egyszeri rezsim vagy a 14 naponta egyszeri rezsim. A következõ példák jellemzik a találmány megvalósítási módjait. Értelemszerûen, azonban, a találmány megvalósítási módjai nem korlátozódnak ezen példák specifikus részleteire, mivel egyéb változatai közönséges szakember számára ismertek, vagy egyértelmûek 19

20 1 HU T2 2 a jelen kitanítás és kapcsolódó igénypontok fényében. Az összes hivatkozott dokumentum hivatkozásként a leírás részét képezi. Példák 1. példa Lineáris K és K mpeg és K maleimid (EC)hPYY 3 36 Ez a példa lényegében homogén monopegezett (EC)hPYY változatot ad, ahol az mpeg (K vagy K) a. aminosavnál kapcsolódik. (a) Az (EC)hPYY 3 36 elõállítása (EC)PYY polipeptidet szintetizáltunk szilárd fázisú eljárással Fmoc stratégia alkalmazásával 2¹(1Hbenzotrizole-1¹il)-1,1,3,3-tetrametil-urónium-hexafluorfoszfát (HBTU) aktiválással (Fastmoc, 0,1 mmol ciklusok) automata peptidszintetizátor készülék alkalmazásával (433A model; Applied Biosystems, Foster City, CA). Az alkalmazott oldallánc-védõcsoportok a következõk voltak: Trt az Asn, Gln, Cys és His esetében; tbu a Ser, Thr és Tyr esetében; Boc a Lys esetében; OtBu az Asp és Glu esetében; és Pbf az Arg esetében. A peptid-gyanta hasítást 9 ml trifluor-ecetsav (TFA), 0, g fenol, 0, ml H 2 O, 0, ml tioanizol és 0,2 ml 1,2-etánditiol keverékével szobahõmérsékleten végeztük 4 órán át. A peptidet jéghideg etil-éterben csaptuk ki, és mostuk etil-éterrel, feloldottuk DMSO-ban és fordított fázisú HPLC-vel tisztítottuk Waters Deltapak C18, 1 m, 0 Å, 0 0 mm ID oszlopon (Cat # WAT011801, Waters, Milford, MA) lineáris gradiens alkalmazásával 0% A oldószer: 0% B oldószertõl 70% A oldószer: % B oldószerig, perc alatt 80 ml/min áramlási sebességgel. Az A oldószer vizes 0,1% TFA (trifluor-ecetsav)-oldat. A B oldószer 0,1% TFA-oldat acetonitrilben. A tisztított peptid molekulatömegét igazoltuk ESI¹MS alkalmazásával (M Avg= 24), a tisztaságot pedig fordított fázisú HPLC alkalmazásával határoztuk meg (1. ábra). (b) Lineáris K mpeg-maleimid (EC)hPYY 3 36 elõállítása Lineáris mpeg-maleimid-reagenst, amely körülbelül 000 MW volt (Sunbright ME¹0MA, NOF Corporation, Tokió, Japán) szelektíven kapcsoltunk (EC)hPYY polipeptidhez a. cisztein-aminosav szulfhidril csoportjához. Lineáris K mpeg-maleimid, feloldva mm HEPES-ben (Sigma Chemical, St. Louis, MO) ph=7,0, vagy alternatív esetben, mm nátrium-acetátban (Sigma Chemical, St. Louis, MO) ph=4,, azonnal reagáltatva volt (EC)hPYY peptiddel a peptid közvetlen hozzáadásával, amely körülbelül 1 mg/ml peptidkoncentrációt adott és körülbelül 1:1 relatív mpeg:(ec)hpyy 3 36 moláris arányt. A reakciókat sötétben, szobahõmérsékleten végeztük 0, 24 óráig. A HEPES-ben ph=7,0 végzett reakciók mm nátrium-acetátba ph=4, történõ hígítással lettek leállítva, kationcserélõ kromatográfiás azonnali tisztításhoz. A mm nátrium-acetátban, ph=4,, lévõ reakciókat közvetlenül töltöttük a kationcserélõ kromatográfiára. A reakciótermékeket SEC HPLC-vel határoztuk meg (2. ábra). (c) Lineáris K mpeg-maleimid (EC)hPYY 3 36 tisztítása A pegezett (EC)hPYY peptideket a reakciókeverékbõl tisztítottuk >9%¹ra egyetlen ioncsere-kromatográfiás lépés alkalmazásával. Monopegezett (EC)hPYY peptidet tisztítottunk nem módosított (EC)hPYY peptidbõl és nagy molekulatömegûekbõl kationcsere-kromatográfia alkalmazásával. Egy jellemzõ lineáris K mpeg-maleimid (EC)hPYY 3 36 reakciókeverék ( mg protein), amint fent ismertettük, frakcionálva volt SP¹Sepharose Hitrap oszlopon ( ml) (Amersham Pharmacia Biotech, GE Healthcare, Piscataway, NJ), amely mm nátrium-acetáttal volt ekvilibrálva, ph=4, (A puffer). A reakciókeveréket hétszeresére hígítottuk az A pufferrel és az oszlopra töltöttük 2, ml/min áramlási sebességgel. Az oszlopot oszloptérfogatnyi A pufferrel mostuk. Ezt követõen különbözõ fajta (EC)hPYY polipeptidek eluálódtak az oszlopról NaCl térfogatnyi 0 0 mm lineáris gradiensével. Az eluenst 280 nm¹es (A 280 ) abszorbanciával monitoroztuk és megfelelõ méretû frakciókat gyûjtöttünk be. A frakciókat a pegezés mértékében öntöttük össze, amit SDS-PAGE alkalmazásával határoztunk meg (3. ábra). A tisztított frakciókat ezt követõen betöményítettük 0, mg/ml koncentrációra egy Centriprep 3 betöményítõkészülékben (Amicon Technology Corporation, Northborough, MA) vagy alternatív esetben Vivaspin K betöményítõ alkalmazásával (Vivascience Sartorius Group, Hannover, Németország). A tisztított összegyûjtött frakciók fehérjekoncentrációjának meghatározását az RP HPLC csúcsterületnek a PYY 3 36 standard görbéhez (nem mutatjuk) történõ összehasonlításával végeztük, vagy alternatív esetben az összegyûjtött frakciók koncentrációját a 280 nm¹es abszorbanciával határoztuk meg kísérletesen meghatározott extinkciós koefficiensek alkalmazásával. Pegezett (EC)hPYY 3 36 tisztított adagját SEC HPLC-vel határoztuk meg, amint azt a 6. ábrán mutatjuk. (d) Lineáris K mpeg-maleimid (EC)hPYY 3 36 elõállítása Lineáris mpeg-maleimid-reagenst, amely körülbelül 000 MW volt (Sunbright ME¹0MA, NOF Corporation) szelektíven kapcsoltunk (EC)hPYY polipeptidhez a. cisztein-aminosav szulfhidril csoportjához. Lineáris K mpeg-maleimidet, feloldva mm nátrium-acetátban (Sigma Chemical, St. Luis, MO) ph=4,, azonnal reagáltattunk (EC)h PYY peptiddel, a peptid közvetlen hozzáadásával, hogy 1 mg/ml peptidkoncentráció jöjjön létre és körülbelül 1,3:1 mpeg:(ec)hpyy 3 36 relatív moláris arány jöjjön létre. A reakciókat sötétben, szobahõmérsékleten végeztük percig, ezt követõen 4 C¹on 16 óráig. A mm nátrium-acetátban, ph=4,, lévõ reakciókat közvetlenül töltöttük a kationcserélõ kromatográfiára. A reakciótermékeket SEC HPLC-vel határoztuk meg.

avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest

avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest Iparilag alkalmazható szekvenciák, avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest Neutrokin α - jelentős kereskedelmi érdekek



TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL Az egyes biomolekulák izolálása kulcsfontosságú a biológiai szerepük tisztázásához. Az affinitás kromatográfia egyszerűsége, reprodukálhatósága



(11) Lajstromszám: E 008 532 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000832T2! (19) HU (11) Lajstromszám: E 008 32 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 783231 (22) A bejelentés


Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia

Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia Fehérje expressziós rendszerek Gyógyszerészi Biotechnológia Expressziós rendszerek Cél: rekombináns fehérjék előállítása nagy tisztaságban és nagy mennyiségben kísérleti ill. gyakorlati (therapia) felhasználásokra



(11) Lajstromszám: E 008 370 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008370T2! (19) HU (11) Lajstromszám: E 008 370 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 750224 (22) A bejelentés



(11) Lajstromszám: E 008 257 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000827T2! (19) HU (11) Lajstromszám: E 008 27 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 727848 (22) A bejelentés



(11) Lajstromszám: E 005 570 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000070T2! (19) HU (11) Lajstromszám: E 00 70 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 80947 (22) A bejelentés napja: 2006.



(11) Lajstromszám: E 007 751 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007751T2! (19) HU (11) Lajstromszám: E 007 751 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 810619 (22) A bejelentés napja:



(11) Lajstromszám: E (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000004794T2! (19) HU (11) Lajstromszám: E 004 794 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 05 291297 (22) A bejelentés napja:



(11) Lajstromszám: E 004 725 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000472T2! (19) HU (11) Lajstromszám: E 004 72 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 7372 (22) A bejelentés napja: 04.



(11) Lajstromszám: E 005 510 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000010T2! (19) HU (11) Lajstromszám: E 00 10 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 769233 (22) A bejelentés napja: 2004.



(11) Lajstromszám: E 007 384 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007384T2! (19) HU (11) Lajstromszám: E 007 384 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 757801 (22) A bejelentés napja:


SZABADALMI IGÉNYPONTOK. képlettel rendelkezik:

SZABADALMI IGÉNYPONTOK. képlettel rendelkezik: SZABADALMI IGÉNYPONTOK l. Izolált atorvasztatin epoxi dihidroxi (AED), amely az alábbi képlettel rendelkezik: 13 2. Az l. igénypont szerinti AED, amely az alábbiak közül választott adatokkal jellemezhető:


Klónozás: tökéletesen egyforma szervezetek csoportjának előállítása, vagyis több genetikailag azonos egyed létrehozása.

Klónozás: tökéletesen egyforma szervezetek csoportjának előállítása, vagyis több genetikailag azonos egyed létrehozása. Növények klónozása Klónozás Klónozás: tökéletesen egyforma szervezetek csoportjának előállítása, vagyis több genetikailag azonos egyed létrehozása. Görög szó: klon, jelentése: gally, hajtás, vessző. Ami



(11) Lajstromszám: E 006 819 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000006819T2! (19) HU (11) Lajstromszám: E 006 819 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 7669 (22) A bejelentés napja:


NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYGENETIKA Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 A NÖVÉNYI TÁPANYAG TRANSZPORTEREK az előadás áttekintése A tápionok útja a növényben Növényi tápionok passzív és



(11) Lajstromszám: E 006 472 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000006472T2! (19) HU (11) Lajstromszám: E 006 472 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 788982 (22) A bejelentés napja:



ENZIMEK BIOTECHNOLÓGIAI ELŐÁLLÍTÁSA Az élettudományi-klinikai felsőoktatás gyakorlatorientált és hallgatóbarát korszerűsítése a vidéki képzőhelyek nemzetközi versenyképességének erősítésére TÁMOP-4.1.1.C-13/1/KONV-2014-0001 ENZIMEK BIOTECHNOLÓGIAI



(11) Lajstromszám: E 007 625 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000076T2! (19) HU (11) Lajstromszám: E 007 6 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 79689 (22) A bejelentés napja: 0.


A preventív vakcináció lényege :

A preventív vakcináció lényege : Vakcináció Célja: antigénspecifkus immunválasz kiváltása a szervezetben A vakcina egy olyan készítmény, amely fokozza az immunitást egy adott betegséggel szemben (aktiválja az immunrendszert). A preventív


A növény inváziójában szerepet játszó bakteriális gének

A növény inváziójában szerepet játszó bakteriális gének A növény inváziójában szerepet játszó bakteriális gének merisztéma korai szimbiotikus zóna késői szimbiotikus zóna öregedési zóna gyökér keresztmetszet NODULÁCIÓ növényi jel Rhizobium meliloti rhizobium



(11) Lajstromszám: E (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000004045T2! (19) HU (11) Lajstromszám: E 004 045 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 770559 (22) A bejelentés napja:



(11) Lajstromszám: E (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008262T2! (19) HU (11) Lajstromszám: E 008 262 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 725251 (22) A bejelentés napja:



(11) Lajstromszám: E 003 868 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000003868T2! (19) HU (11) Lajstromszám: E 003 868 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 73619 (22) A bejelentés napja:


Molekuláris genetikai vizsgáló. módszerek az immundefektusok. diagnosztikájában

Molekuláris genetikai vizsgáló. módszerek az immundefektusok. diagnosztikájában Molekuláris genetikai vizsgáló módszerek az immundefektusok diagnosztikájában Primer immundefektusok A primer immundeficiencia ritka, veleszületett, monogénes öröklődésű immunhiányos állapot. Családi halmozódást


Megtekinthetővé vált szabadalmi leírások

Megtekinthetővé vált szabadalmi leírások ( 11 ) 227.096 ( 54 ) Eljárás és elrendezés töltési szint mérésére ( 11 ) 227.097 ( 54 ) Mágneses kezelőegység folyékony és légnemű anyagokhoz ( 11 ) 227.098 ( 54 ) Biológiai sejtek azonosítására és számlálására


6. változat. 3. Jelöld meg a nem molekuláris szerkezetű anyagot! A SO 2 ; Б C 6 H 12 O 6 ; В NaBr; Г CO 2.

6. változat. 3. Jelöld meg a nem molekuláris szerkezetű anyagot! A SO 2 ; Б C 6 H 12 O 6 ; В NaBr; Г CO 2. 6. változat Az 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Jelöld meg azt a sort, amely helyesen


A szamóca érése során izolált Spiral és Spermidin-szintáz gén jellemzése. Kiss Erzsébet Kovács László

A szamóca érése során izolált Spiral és Spermidin-szintáz gén jellemzése. Kiss Erzsébet Kovács László A szamóca érése során izolált Spiral és Spermidin-szintáz gén jellemzése Kiss Erzsébet Kovács László Bevezetés Nagy gazdasági gi jelentıségük k miatt a gyümölcs lcsök, termések fejlıdésének mechanizmusát



(11) Lajstromszám: E 007 949 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007949T2! (19) HU (11) Lajstromszám: E 007 949 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 07 835738 (22) A bejelentés napja:


(11) Lajstromszám: E 004 888 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (I)

(11) Lajstromszám: E 004 888 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (I) !HU000004888T2! (19) HU (11) Lajstromszám: E 004 888 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 770962 (22) A bejelentés napja:



(11) Lajstromszám: E (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007147T2! (19) HU (11) Lajstromszám: E 007 147 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 007068 (22) A bejelentés napja:



(11) Lajstromszám: E 008 536 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008536T2! (19) HU (11) Lajstromszám: E 008 536 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 05 717379 (22) A bejelentés


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi



(11) Lajstromszám: E 006 234 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000006234T2! (19) HU (11) Lajstromszám: E 006 234 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 700417 (22) A bejelentés napja:


A genetikai lelet értelmezése monogénes betegségekben

A genetikai lelet értelmezése monogénes betegségekben A genetikai lelet értelmezése monogénes betegségekben Tory Kálmán Semmelweis Egyetem, I. sz. Gyermekklinika A ~20 ezer fehérje-kódoló gén a 23 pár kromoszómán A kromoszómán található bázisok száma: 250M



(11) Lajstromszám: E 007 952 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000792T2! (19) HU (11) Lajstromszám: E 007 92 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 73892 (22) A bejelentés napja:



(11) Lajstromszám: E 008 405 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008T2! (19) HU (11) Lajstromszám: E 008 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 77970 (22) A bejelentés napja:


1. változat. 4. Jelöld meg azt az oxidot, melynek megfelelője a vas(iii)-hidroxid! A FeO; Б Fe 2 O 3 ; В OF 2 ; Г Fe 3 O 4.

1. változat. 4. Jelöld meg azt az oxidot, melynek megfelelője a vas(iii)-hidroxid! A FeO; Б Fe 2 O 3 ; В OF 2 ; Г Fe 3 O 4. 1. változat z 1-től 16-ig terjedő feladatokban négy válaszlehetőség van, amelyek közül csak egy helyes. Válaszd ki a helyes választ és jelöld be a válaszlapon! 1. Melyik sor fejezi be helyesen az állítást:





DNS-szekvencia meghatározás

DNS-szekvencia meghatározás DNS-szekvencia meghatározás Gilbert 1980 (1958) Sanger 3-1 A DNS-polimerázok jellemzői 5'-3' polimeráz aktivitás 5'-3' exonukleáz 3'-5' exonukleáz aktivitás Az új szál szintéziséhez kell: templát DNS primer


Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén

Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Dr. Dallmann Klára A molekuláris biológia célja az élőlények és sejtek működésének molekuláris szintű


A replikáció mechanizmusa

A replikáció mechanizmusa Az öröklődés molekuláris alapjai A DNS megkettőződése, a replikáció Szerk.: Vizkievicz András A DNS-molekula az élőlények örökítő anyaga, kódolt formában tartalmazza mindazon információkat, amelyek a sejt,



(11) Lajstromszám: E 003 829 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000003829T2! (19) HU (11) Lajstromszám: E 003 829 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 82032 (22) A bejelentés napja:



(11) Lajstromszám: E 004 263 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000004263T2! (19) HU (11) Lajstromszám: E 004 263 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 70014 (22) A bejelentés napja:



GLUCAGONUM HUMANUM. Humán glükagon 01/2008:1635 GLUCAGONUM HUMANUM Humán glükagon C 153 H 225 N 43 O 49 S M r 3483 DEFINÍCIÓ A humán glükagon 29 aminosavból álló polipeptid; szerkezete megegyezik az emberi hasnyálmirígy α-sejtjei által


DER (Felületén riboszómák találhatók) Feladata a biológiai fehérjeszintézis Riboszómák. Az endoplazmatikus membránrendszer. A kódszótár.

DER (Felületén riboszómák találhatók) Feladata a biológiai fehérjeszintézis Riboszómák. Az endoplazmatikus membránrendszer. A kódszótár. Az endoplazmatikus membránrendszer Részei: DER /durva (szemcsés) endoplazmatikus retikulum/ SER /sima felszínű endoplazmatikus retikulum/ Golgi készülék Lizoszómák Peroxiszómák Szekréciós granulumok (váladékszemcsék)


Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással

Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Kovács Zoltán ügyvezető DEKUT Debreceni Kutatásfejlesztési Közhasznú Nonprofit Kft. Problémadefiníció Első generációs



(11) Lajstromszám: E 005 115 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000011T2! (19) HU (11) Lajstromszám: E 00 11 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 21 (22) A bejelentés napja: 0. 06.



(11) Lajstromszám: E 005 730 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000005730T2! (19) HU (11) Lajstromszám: E 005 730 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 741052 (22) A bejelentés napja:



(11) Lajstromszám: E 006 093 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000093T2! (19) HU (11) Lajstromszám: E 006 093 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 749886 (22) A bejelentés napja:


Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására

Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására Szalma Katalin Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására Témavezető: Dr. Turai István, OSSKI Budapest, 2010. október 4. Az ionizáló sugárzás sejt kölcsönhatása Antone


Új terápiás lehetőségek (receptorok) a kardiológiában

Új terápiás lehetőségek (receptorok) a kardiológiában Új terápiás lehetőségek (receptorok) a kardiológiában Édes István Kardiológiai Intézet, Debreceni Egyetem Kardiomiociták Ca 2+ anyagcseréje és új terápiás receptorok 2. 1. 3. 6. 6. 7. 4. 5. 8. 9. Ca



(11) Lajstromszám: E 007 328 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007328T2! (19) HU (11) Lajstromszám: E 007 328 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 797669 (22) A bejelentés napja:


A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata

A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata Ph.D. ÉRTEKEZÉS TÉZISEI A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata Buzás-Bereczki Orsolya Témavezetők: Dr. Bálint Éva Dr. Boros Imre Miklós Biológia



(11) Lajstromszám: E 006 740 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000067T2! (19) HU (11) Lajstromszám: E 006 7 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 293297 (22) A bejelentés napja: 03.


(11) Lajstromszám: E 003 213 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA. (51) Int. Cl.: A01C 7/04 (2006.01)

(11) Lajstromszám: E 003 213 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA. (51) Int. Cl.: A01C 7/04 (2006.01) !HU000003213T2! (19) HU (11) Lajstromszám: E 003 213 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 005442 (22) A bejelentés napja:


Az elhízás hatása az emberi szervezetre. Dr. Polyák József Pharmamedcor Kardiológiai Szakambulancia 1137. Budapest, Katona J. u. 27.

Az elhízás hatása az emberi szervezetre. Dr. Polyák József Pharmamedcor Kardiológiai Szakambulancia 1137. Budapest, Katona J. u. 27. Az elhízás hatása az emberi szervezetre Dr. Polyák József Pharmamedcor Kardiológiai Szakambulancia 1137. Budapest, Katona J. u. 27. Melyek az élő szervezet elemi életjelenségei közül minőségében testtömeg



(11) Lajstromszám: E 007 800 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007800T2! (19) HU (11) Lajstromszám: E 007 800 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 787403 (22) A bejelentés napja:



(11) Lajstromszám: E 003 189 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000003189T2! (19) HU (11) Lajstromszám: E 003 189 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 7082 (22) A bejelentés napja:



(11) Lajstromszám: E 008 612 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008612T2! (19) HU (11) Lajstromszám: E 008 612 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 76412 (22) A bejelentés



(11) Lajstromszám: E 008 015 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008015T2! (19) HU (11) Lajstromszám: E 008 015 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 778847 (22) A bejelentés napja:


Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek

Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Több oxigéntartalmú funkciós csoportot tartalmazó vegyületek Hidroxikarbonsavak α-hidroxi karbonsavak -Glikolsav (kézkrémek) - Tejsav (tejtermékek, izomláz, fogszuvasodás) - Citromsav (citrusfélékben,



(11) Lajstromszám: E 004 313 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000004313T2! (19) HU (11) Lajstromszám: E 004 313 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 771807 (22) A bejelentés napja:


Helyi érzéstelenítők farmakológiája

Helyi érzéstelenítők farmakológiája Helyi érzéstelenítők farmakológiája SE Arc-Állcsont-Szájsebészeti és Fogászati Klinika BUDAPEST Definíció Farmakokinetika: a gyógyszerek felszívódásának, eloszlásának, metabolizmusának és kiürülésének


(11) Lajstromszám: E (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA. (51) Int. Cl.: A22C 13/00 ( )

(11) Lajstromszám: E (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA. (51) Int. Cl.: A22C 13/00 ( ) !HU00000320T2! (19) HU (11) Lajstromszám: E 003 20 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 44126 (22) A bejelentés napja:


3. A 2. igénypont szerinti készítmény, amely 0,03 törnego/o-nál kisebb. 4. A 3. igénypont szerinti készítmény, amely 0,02 tömeg 0 /o-nál kisebb

3. A 2. igénypont szerinti készítmény, amely 0,03 törnego/o-nál kisebb. 4. A 3. igénypont szerinti készítmény, amely 0,02 tömeg 0 /o-nál kisebb SZABADALMI IGÉNYPONTOK l. Pravasztatint és O, l tömeg%-nál kisebb rnennyiségü pravasztatin C-t tartalmazó készítmény. 2. Az l. igénypont szerinti készítmény, amely 0,04 törnego/o-nál kisebb rnennyiségü


Az ellenanyagok orvosbiológiai. PhD kurzus 2011/2012 II. félév

Az ellenanyagok orvosbiológiai. PhD kurzus 2011/2012 II. félév Az ellenanyagok orvosbiológiai alkalmazása PhD kurzus 2011/2012 II. félév Ellenanyagok előállítása, tisztítása, jelölése, fragmentálása Monoklonális vs. poliklonális ellenanyagok Ellenanyagok előállítása


Az adenovírusok morfológiája I.

Az adenovírusok morfológiája I. Adenovírusok A vírusok Elnevezésük a latin virus szóból ered, amelynek jelentése méreg. A vírusok a legkisebb ismert entitások. Csak elektronmikroszkóppal tanulmányozhatóak, mert méretük 20-400 nanométerig


5. Molekuláris biológiai technikák

5. Molekuláris biológiai technikák 5. Molekuláris biológiai technikák DNS szaporítás kémcsőben és élőben. Klónozás, PCR, cdna, RT-PCR, realtime-rt-pcr, Northern-, Southernblotting, génexpresszió, FISH 5. Molekuláris szintű biológiai technikák


Evolúcióelmélet és az evolúció mechanizmusai

Evolúcióelmélet és az evolúció mechanizmusai Evolúcióelmélet és az evolúció mechanizmusai Az élet Darwini szemlélete Melyek az evolúció bizonyítékai a világban? EVOLÚCIÓ: VÁLTOZATOSSÁG Mutáció Horizontális géntranszfer Genetikai rekombináció Rekombináció


Hús és hústermék, mint funkcionális élelmiszer

Hús és hústermék, mint funkcionális élelmiszer Hús és hústermék, mint funkcionális élelmiszer Szilvássy Z., Jávor A., Czeglédi L., Csiki Z., Csernus B. Debreceni Egyetem Funkcionális élelmiszer Első használat: 1984, Japán speciális összetevő feldúsítása


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi



(11) Lajstromszám: E 007 635 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007635T2! (19) HU (11) Lajstromszám: E 007 635 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 07 823526 (22) A bejelentés napja:


A Telomerase-specific Doxorubicin-releasing Molecular Beacon for Cancer Theranostics

A Telomerase-specific Doxorubicin-releasing Molecular Beacon for Cancer Theranostics A Telomerase-specific Doxorubicin-releasing Molecular Beacon for Cancer Theranostics Yi Ma, Zhaohui Wang, Min Zhang, Zhihao Han, Dan Chen, Qiuyun Zhu, Weidong Gao, Zhiyu Qian, and Yueqing Gu Angew. Chem.



NANOTECHNOLOGIA 6. előadás NANOTECHNOLOGIA 6. előadás A plazmid: Ha meg akarjuk ismerni egy fehérje működését, akkor sokat kell belőle előállítanunk. Ezt akár úgy is megtehetjük, hogy a kívánt géndarabot egy baktérumba ültetjük



(11) Lajstromszám: E 007 770 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007770T2! (19) HU (11) Lajstromszám: E 007 770 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 738093 (22) A bejelentés napja:



(11) Lajstromszám: E 006 966 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000006966T2! (19) HU (11) Lajstromszám: E 006 966 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 717644 (22) A bejelentés napja:


folsav, (a pteroil-glutaminsav vagy B 10 vitamin) dihidrofolsav tetrahidrofolsav N CH 2 N H H 2 N COOH

folsav, (a pteroil-glutaminsav vagy B 10 vitamin) dihidrofolsav tetrahidrofolsav N CH 2 N H H 2 N COOH folsav, (a pteroil-glutaminsav vagy B 10 vitamin) 2 2 2 2 pirimidin rész pirazin rész aminobenzoesav rész glutaminsav rész pteridin rész dihidrofolsav 2 2 2 2 tetrahidrofolsav 2 2 2 2 A dihidrofolát-reduktáz



ADATBÁNYÁSZAT I. ÉS OMICS Az élettudományi-klinikai felsőoktatás gyakorlatorientált és hallgatóbarát korszerűsítése a vidéki képzőhelyek nemzetközi versenyképességének erősítésére TÁMOP-4.1.1.C-13/1/KONV-2014-0001 ADATBÁNYÁSZAT



(11) Lajstromszám: E 007 017 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007017T2! (19) HU (11) Lajstromszám: E 007 017 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 07 7232 (22) A bejelentés napja:


Javítókulcs (Kémia emelt szintű feladatsor)

Javítókulcs (Kémia emelt szintű feladatsor) Javítókulcs (Kémia emelt szintű feladatsor) I. feladat 1. C 2. B. fenolos hidroxilcsoport, éter, tercier amin db. ; 2 db. 4. észter 5. E 6. A tercier amino-nitrogén. 7. Pl. a trimetil-amin reakciója HCl-dal.



(11) Lajstromszám: E 006 499 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000006499T2! (19) HU (11) Lajstromszám: E 006 499 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 78626 (22) A bejelentés napja:


(11) Lajstromszám: E (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA. (51) Int. Cl.: A01C 7/04 ( )

(11) Lajstromszám: E (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA. (51) Int. Cl.: A01C 7/04 ( ) !HU000003148T2! (19) HU (11) Lajstromszám: E 003 148 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 005441 (22) A bejelentés napja:


Molekuláris terápiák

Molekuláris terápiák Molekuláris terápiák Aradi, János Balajthy, Zoltán Csősz, Éva Scholtz, Beáta Szatmári, István Tőzsér, József Varga, Tamás Szerkesztette Balajthy, Zoltán és Tőzsér, József, Debreceni Egyetem Molekuláris


Engedélyszám: 18211-2/2011-EAHUF Verziószám: 1. 2460-06 Humángenetikai vizsgálatok követelménymodul szóbeli vizsgafeladatai

Engedélyszám: 18211-2/2011-EAHUF Verziószám: 1. 2460-06 Humángenetikai vizsgálatok követelménymodul szóbeli vizsgafeladatai 1. feladat Ismertesse a gyakorlaton lévő szakasszisztens hallgatóknak a PCR termékek elválasztása céljából végzett analitikai agaróz gélelektroforézis során használt puffert! Az ismertetés során az alábbi



REKOMBINÁNS FEHÉRJÉK IPARI MÉRETŰ ELŐÁLLÍTÁSA I. Az élettudományi-klinikai felsőoktatás gyakorlatorientált és hallgatóbarát korszerűsítése a vidéki képzőhelyek nemzetközi versenyképességének erősítésére TÁMOP-4.1.1.C-13/1/KONV-2014-0001 REKOMBINÁNS FEHÉRJÉK



(11) Lajstromszám: E 008 546 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000846T2! (19) HU (11) Lajstromszám: E 008 46 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 780262 (22) A bejelentés



(11) Lajstromszám: E 003 099 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000099T2! (19) HU (11) Lajstromszám: E 003 099 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 76424 (22) A bejelentés napja:



(11) Lajstromszám: E 004 563 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000463T2! (19) HU (11) Lajstromszám: E 004 63 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 749820 (22) A bejelentés napja:


Fotoszintézis. fotoszintetikus pigmentek Fényszakasz - gránum/sztrómalamella. Sötétszakasz - sztróma

Fotoszintézis. fotoszintetikus pigmentek Fényszakasz - gránum/sztrómalamella. Sötétszakasz - sztróma Fotoszintézis fotoszintetikus pigmentek Fényszakasz - gránum/sztrómalamella Sötétszakasz - sztróma A növényeket érı hatások a pigmentösszetétel változását okozhatják I. Mintavétel (inhomogén minta) II.



(11) Lajstromszám: E 007 747 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007747T2! (19) HU (11) Lajstromszám: E 007 747 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 803296 (22) A bejelentés napja:


11. Dr. House. Biokémiai és sejtbiológiai módszerek alkalmazása az orvoslásban

11. Dr. House. Biokémiai és sejtbiológiai módszerek alkalmazása az orvoslásban 11. Dr. House. Biokémiai és sejtbiológiai módszerek alkalmazása az orvoslásban HIV fertőzés kimutatása - (fiktív) esettanulmány 35 éves nő, HIV fertőzöttség gyanúja. Két partner az elmúlt időszakban. Fertőzött-e


(11) Lajstromszám: E 007 146 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA. (51) Int. Cl.: E01F 8/02 (2006.01) 1. ábra

(11) Lajstromszám: E 007 146 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA. (51) Int. Cl.: E01F 8/02 (2006.01) 1. ábra !HU000007146T2! (19) HU (11) Lajstromszám: E 007 146 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 05 012715 (22) A bejelentés napja:


9. Szilárdfázisú szintézisek. oligopeptidek, oligonukleotidok

9. Szilárdfázisú szintézisek. oligopeptidek, oligonukleotidok 9. Szilárdfázisú szintézisek oligopeptidek, oligonukleotidok Peptidszintézis Amidkötés kialakítása R O OH + H 2 N Q R O Q N + H 2 O H R O OH + H 2 N Q R O O + H 3 N Q sav-bázis reakció már nem nukleofil



(11) Lajstromszám: E 007 404 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000074T2! (19) HU (11) Lajstromszám: E 007 4 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 7796 (22) A bejelentés napja: 03.



(11) Lajstromszám: E 005 758 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000078T2! (19) HU (11) Lajstromszám: E 00 78 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 766 (22) A bejelentés napja: 03.


Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 7. előadás Immunizálás. Poliklonális és monoklonális ellenanyag előállítása, tisztítása, alkalmazása Az antigén (haptén + hordozó) sokféle specificitású ellenanyag



CIÓ A GENETIKAI INFORMÁCI A DNS REPLIKÁCI A GENETIKAI INFORMÁCI CIÓ TÁROLÁSA ÉS S KIFEJEZŐDÉSE A DNS SZERKEZETE Két antiparalel (ellentétes lefutású) polinukleotid láncból álló kettős helix A két lánc egy képzeletbeli közös tengely körül van feltekeredve,



(11) Lajstromszám: E 008 371 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008371T2! (19) HU (11) Lajstromszám: E 008 371 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 792947 (22) A bejelentés


Kereskedelmi forgalomban lévő rekombináns gyógyszerkészítmények

Kereskedelmi forgalomban lévő rekombináns gyógyszerkészítmények Kereskedelmi forgalomban lévő rekombináns gyógyszerkészítmények Írta: Barta Zsolt Biomérnök hallgató 2007 Tartalomjegyzék 1 Rekombináns inzulin [1]... 3 2 A humán növekedési hormon rekombináns módon történő
