EGY AGYI SZERIN PROTEÁZ, A HUMÁN TRIPSZIN 4 FUNKCIONÁLIS VIZSGÁLATA

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "EGY AGYI SZERIN PROTEÁZ, A HUMÁN TRIPSZIN 4 FUNKCIONÁLIS VIZSGÁLATA"

Átírás

1 EGY AGYI SZERIN PROTEÁZ, A HUMÁN TRIPSZIN 4 FUNKCIONÁLIS VIZSGÁLATA A humán tripszinogén 4 transzkripciójának vizsgálata valamint az enzim aktivációja és működése során bekövetkező szerkezeti átrendeződések gyorskinetikai és termodinamikai elemzése Doktori (PhD) értekezés Tóth Júlia Biológia Doktori Iskola Iskolavezető: Prof. Erdei Anna, tanszékvezető egyetemi tanár Szerkezeti Biokémia Doktori Program Programvezető: Prof. Gráf László, tanszékvezető egyetemi tanár Témavezetők Dr. Szilágyi László, egyetemi docens Dr. Málnási-Csizmadia András, tudományos főmunkatárs Eötvös Loránd Tudományegyetem Természettudományi Kar, Biológiai Intézet, Biokémiai Tanszék Budapest, 2006

2

3 TARTALOMJEGYZÉK TARTALOMJEGYZÉK... 3 RÖVIDÍTÉSEK BEVEZETÉS SZERIN PROTEÁZOK CSOPORTOSÍTÁSA, MEGHATÁROZÁSA AZ S1 CSALÁDBA TARTOZÓ SZERIN PROTEÁZOK TÉRSZERKEZETE A KATALITIKUS TRIÁD AZ OXIANION LYUK A KATALITIKUS MECHANIZMUS BIZONYÍTÉKOK A KATALITIKUS MECHANIZMUS ÉRVÉNYESSÉGÉRE A SZUBSZTRÁTFELISMERŐ-HELY ÉS A SZUBSZTRÁTSPECIFICITÁST MEGHATÁROZÓ TÉNYEZŐK Az S1 hely A polipeptidkötő hely Az S2-Sn helyek Az S1 -S3 helyek A SZERIN PROTEÁZOK AKTIVÁCIÓJA A HUMÁN TRIPSZIN 4 IRODALMI ÁTTEKINTÉSE A humán tripszinogén 4 felfedezése A PRSS3 gén genomi elhelyezkedése és szerkezete A humán tripszinogén 4 mrns alternatív variánsai A humán tripszinogén 4 izoformáinak N-terminális szekvenciája Transzláció iniciáció nem-aug kodonokról A humán tripszinogén 4 izoformáinak transzkripciója A humán tripszinogén 4 izoformáinak expressziója A humán tripszin 4 általános jellemzői A humán tripszin 4 térszerkezete A humán tripszin 4 inhibitor rezisztenciája A humán tripszin 4 szubsztrátspecificitása Az Arg193 szerepe Tripszin inhibitorok hasítása A humán tripszinogén 4 aktivációja A humán tripszin 4 lehetséges funkciói A humán tripszin 4 potenciális fiziológiás és patológiás szerepe a hasnyálmirigyben A humán tripszin 4 potenciális fiziológiás és patológiás szerepe extrapankreatikus szövetekben CÉLKITŰZÉSEK AZ ALKALMAZOTT MÓDSZEREK ELMÉLETI HÁTTERE RACE PCR A TRADICIONÁLIS ÉS A REAL-TIME KVANTITATÍV PCR ÖSSZEHASONLÍTÁSA STEADY STATE ÉS TRANZIENS (PRE-STEADY STATE) KINETIKA ÖSSZEHASONLÍTÁSA ANYAGOK ÉS MÓDSZEREK RACE PCR REAL-TIME KVANTITATÍV PCR Totál RNS izolálása agyszövetből cdns szintézis Külső standardok előállítása Primer tervezés Real-time kvantitatív PCR A HUMÁN TRIPSZINOGÉN 4 A ÉS B IZOFORMÁJÁNAK KLÓNOZÁSA ÉS EXPRESSZIÓJA A HUMÁN TRIPSZINOGÉN 4 MUTÁNSOK ELŐÁLLÍTÁSA A REKOMBINÁNS FEHÉRJÉK ELŐÁLLÍTÁSÁHOZ HASZNÁLT PET E. COLI EXPRESSZIÓS RENDSZER MŰKÖDÉSE A REKOMBINÁNS HUMÁN TRIPSZINOGÉN 4 IZOFORMÁK ÉS MUTÁNSOK EXPRESSZIÓJA, A FEHÉRJÉK TISZTÍTÁSA ÉS AKTIVÁLÁSA MEMBRÁNKÖTÉSI KÍSÉRLETEK STEADY STATE KINETIKAI MÉRÉSEK: A K CAT ÉS A K M MEGHATÁROZÁSA

4 4.9 TRANZIENS KINETIKAI MÉRÉSEK Gyorskinetikai mérések 4-metilumbelliferil 4-guanidinobenzoát szubsztráton A 4-metilumbelliferil 4-guanidinobenzoát reakciók kinetikai és termodinamikai elemzése ph-ugrásos stopped flow mérések Hőugrásos stopped flow ph-ugrás mérések A sebességi állandók relatív külső viszkozitástól való függésének meghatározása A ph-ugrásos mérések kinetikai és termodinamikai analízise EREDMÉNYEK ÉS ÉRTELMEZÉSÜK A HUMÁN TRIPSZINOGÉN 4 MRNS 5 VÉGI SZEKVENCIÁJÁNAK MEGHATÁROZÁSA 5 RACE PCR-REL A HUMÁN TRIPSZINOGÉN 4 A, B, ILLETVE REKC IZOFORMA MEMBRÁNKÖTŐ KÉPESSÉGÉNEK VIZSGÁLATA A HUMÁN TRIPSZINOGÉN 4 MRNS MENNYISÉGI MÉRÉSE REAL-TIME KVANTITATÍV PCR-REL Real-time kvantitatív PCR reakció körülményeinek optimalizálása A Ct értékek mrns mennyiségre való konvertálása és a kalibrálóegyenesek meghatározása A real-time PCR reakciók specificitása A humán tripszinogén 4 mrns relatív mennyiségének eloszlása az agyban A VAD TÍPUSÚ ÉS AZ R193G MUTÁNS HUMÁN TRIPSZIN 4 ÉS A 4-METILUMBELLIFERIL 4-GUANIDINOBENZOÁT SZUBSZTRÁT ANALÓG REAKCIÓJÁNAK KINETIKAI ÉS TERMODINAMIKAI ELEMZÉSE Az időgörbék lefutása A megfigyelt sebességi állandók szubsztrátkoncentráció-függése A reakció leírására felállított modell és annak validálása Az elemi reakciólépések sebességi állandóinak származtatása A vad típusú és az R193G mutáns humán tripszin 4 katalitikus ciklusának összehasonlítása A második és harmadik reakciólépés termodinamikai paraméterei A vad típusú és R193G mutáns humán tripszin 4 MUGB szubsztráton mért kinetikai és termodinamikai paramétereinek értelmezése Az egyedi reakciólépések szeparálását lehetővé tevő szerkezeti okok A tranziens kinetikai adatok alapján felállított finomított modell A G193R mutáció hatása az egyes reakciólépések sebességére A G193R mutáció hatása az első tetraéderes intermedier kialakulásának termodinamikájára A PH-UGRÁSSAL KIVÁLTOTT AKTIVÁCIÓ SORÁN BEKÖVETKEZŐ KONFORMÁCIÓVÁLTOZÁS GYORSKINETIKAI VIZSGÁLATA ÉS TERMODINAMIKÁJÁNAK ELEMZÉSE A vad típusú és 193-as pozícióban mutáns humán tripszin 4 variánsok steady state aktivitása A ph-ugrással kiváltott aktiváció során bekövetkező konformációváltozás kinetikai elemzése A ph-ugrással kiváltott aktiváció során bekövetkező konformációváltozás termodinamikájának vizsgálata A konformációs átmenet sebességének hőmérsékletfüggése A konformációs átmenet sebességének függése a reakcióközeg viszkozitásától A konformációs átmenet kinetikai és termodinamikai paramétereinek értelmezése A triptofán alapú detektálás előnyei és a megfigyelt sebességi állandó értelmezése A Gly193 nagyobb oldalláncú aminosavra való cseréjének szerkezeti következményei A Gly193 nagyobb oldalláncú aminosavra való cseréjének hatása a konformációs átmenet kinetikai és termodinamikai tulajdonságaira A G193A mutáció hatása a tripszin belső viszkozitására ÖSSZEFOGLALÁS SUMMARY KÖSZÖNETNYILVÁNÍTÁS IRODALOMJEGYZÉK FÜGGELÉK

5 RÖVIDÍTÉSEK 5 RACE PCR az mrns 5 végének amplifikálására alkalmas PCR módszer α1at alfa-1-antitripszin APPI Alzheimer amiloid prekurzor protein inhibitor CABS 4-(ciklohexilamino)-1-butánszulfonsav cdns mrns-ről reverz transzkripcióval átírt DNS Ct érték amplifikálási ciklus küszöbérték/ DEPC dietil pirokarbonát DNS 2 -dezoxiribonukleinsav dntp 2 -dezoxinukleotid 5 -trifoszfát DTT ditiotreitol E. coli Escherichia coli ER endoplazmatikus retikulum EST expressed sequence tag (gének rövid szakasza, melyek transzkripciója bizonyított) GFP zöld fluoreszcens protein GSP génspecifikus primer hpsti humán pankreatikus szekréciós tripszin inhibitor mrns messenger (hírvivő) ribonukleinsav MUGB 4-metilumbelliferil 4-guanidinobenzoát PAR proteáz-aktivált receptor Pfu polimeráz Pyrococcus furiosusból izolált hőstabil DNS polimeráz PCR polimeráz láncreakció PRSS szerin proteázt kódoló gén SDS nátrium dodecil szulfát STI szójabab tripszin inhibitor Taq polimeráz Thermus aquaticusból izolált hőstabil DNS polimeráz TI 1 első tetraéderes intermedier Tricin N-[2-hidroxi-1,1-bisz(hidroximetil)etil]glicin Tris Tris-(hidroximetil)-aminometán Z-Gly-Pro-Arg-pNA N-benziloxikarbonil-glicil-prolil-arginil-paranitroanilid 5

6 1. BEVEZETÉS A humán tripszin 4 a 193-as pozícióban a szerin proteázokban konzervált glicin helyett egy arginint tartalmazó tripszin izoforma, amely a hasnyálmirigyben, az agyban, illetve epitheliális eredetű sejtvonalakban expresszálódik. Az enzim széleskörűen karakterizált, legkülönlegesebb tulajdonsága egyes fehérje típusú inhibitorokkal szemben mutatott rezisztenciája. Ez a tripszin izoforma, bár steady state aktivitása kis szintetikus szubsztrátokon nem marad el a többi tripszin izoformáétól, nem képes autoaktivációra, nem aktivál más pankreatikus zimogéneket sem, és polipeptid szubsztrátokon fokozott szubsztrátspecificitást mutat. A humán tripszin 4 benzamidinnel alkotott komplexének szerkezetvizsgálata és mutagenezis tanulmányok felfedték, hogy ezek a különleges tulajdonságok döntően a Gly193Arg mutáció következményei. Az enzim központi idegrendszerben betöltött potenciális funkciója az elmúlt évek során kezdett körvonalazódni. A humán tripszin 4 szelektíven processzálja a mielin bázikus fehérjét, ezáltal szerepet játszhat a sclerosis multiplex pathogenezisében, illetve képes egyes proteáz-aktiválta receptorok hasítására is, így részt vehet jelátviteli folyamatokban. Doktori munkám során a humán tripszinogén 4 gén agyszövetben való transzkripciójával, a humán tripszinogén 4 különböző izoformáinak membránkötő képességével, illetve az enzim aktivációja és működése során bekövetkező szerkezeti átrendeződések gyorskinetikájával és termodinamikájával foglalkoztam. Dolgozatom bevezető részében először általánosságban a szerin proteázok legfontosabb tulajdonságairól írok, majd a humán tripszin 4 irodalmát tekintem át. Ezt követően bemutatom a doktori munkám során alkalmazott módszereket, elért eredményeimet és értelmezem azokat. 1.1 Szerin proteázok csoportosítása, meghatározása A proteázok (más néven proteinázok, peptidázok illetve proteolítikus enzimek) az enzimek egy kiterjedt és fontos csoportja, amelyek peptidkötéseket hidrolizálnak. A Rawlings és Barrett által bevezetett osztályozás szerint a proteázokat elsődleges és harmadlagos szerkezetük alapján családokba, illetve klánokba sorolják, melyek tovább 6

7 csoportosíthatók a katalitikus mechanizmus szerint (Barrett (szerk.) 1998; Barrett és Rawlings 1995). Egy proteáz családot alkot az enzimek azon csoportja, amelynek minden tagja a katalitikus domén aminosav szekvenciájában szignifikáns rokonságot mutat a család legalább egy másik tagjával. Másképpen megfogalmazva, egy család bármely két tagja egy közös ősi molekulából fejlődött, ezért homológnak tekinthető. A családok neve egy, a katalitikus típusra utaló betűből és az azt követő önkényes számból áll. A családok azon csoportja alkot egy klánt, melyek tagjai egy közös ősből fejlődtek, de olyan mértékben divergáltak egymástól, hogy rokonságuk az elsődleges szerkezet összehasonlításával nem fedhető fel (Barrett és Rawlings 1995; Rawlings és Barrett 1993). A tripszin az endopeptidáz szerin proteázok egyik prototípusa, mely a PA klánba és az S1 családba sorolható (Rawlings és mtsi. 2006). A PA klánba szerin és cisztein proteázok tartoznak, melyek két al-klánt (PA(S) és PA(C)) alkotnak. A legtöbb proteáz az exopeptidázok, illetve az endopeptidázok közé sorolható. Exopeptidáznak nevezzük azokat a proteázokat, amelyek egy vagy néhány aminosavat hasítanak le a polipeptid szubsztrát N-, illetve C-terminálisról, endopeptidáznak pedig azokat, amelyek polipeptid láncokon belül hasítanak peptidkötést. A katalitikus mechanizmus alapján megkülönböztethetünk szerin, treonin, cisztein, aszpartát, glutamát és metalloendopeptidázokat, illetve számos enzimben a mechanizmus egyelőre ismeretlen (Rawlings és mtsi. 2006). A szerin, treonin és cisztein proteázokban az aktív helyen a nukleofil szerepét egy aminosav egy csoportja tölti be (ld. 1.5 fejezet), míg az aszpartát és metalloproteázok esetén egy aktivált vízmolekula, a két csoport katalitikus mechanizmusa tehát jelentősen eltér egymástól. A proteázok mintegy egyharmada a szerin proteázok közé sorolható, melyek nevüket az aktív helyen található nukleofil szerin után kapták. Ezt a csoportot eredetileg az Asp-His-Ser katalitikus triád jelenléte alapján különítették el (Blow 1997). Az Asp- His-Ser katalitikus triád legalább négyféle szerkezeti kontextusban található meg, utalva arra, hogy ez a katalitikus gépezet legalább négy különböző alkalommal alakult ki az evolúció során (Dodson és Wlodawer 1998). Ezek az eltérő szerkezetű enzimek négy klánt alkotnak. Az egyik klán prototípusa a tripszin, illetve a kimotripszin. Nemrégiben új katalitikus triádokkal és diádokkal rendelkező szerin proteázokat fedeztek fel, melyekben Ser-His-Glu, Ser-Lys/His, His-Ser-His, és N-terminális Ser játszik szerepet a katalitikus mechanizmusban (Dodson és Wlodawer 1998). Az S1 családba tartozó szerin proteázok megtalálhatók eukariótákban, prokariótákban, archeákban és vírusokban is. Ezek az enzimek számos fiziológiás 7

8 folyamatban vesznek részt, szerepüket leírták például a táplálék emésztésében, jelátviteli folyamatokban, az immunválaszban, a szaporodásban, a hemostasisban és az apoptózisban (Barros és mtsi. 1996; Coughlin 2000; Johnson 2000; Joseph és mtsi. 2001; Neurath 1984). A véralvadást, a fibrinolízist és a komplement rendszer aktiválódását szerin proteázok egymást követő aktiválódási kaszkádja irányítja (Collen és Lijnen 1986; Davidson és mtsi. 1990; Sim és Laich 2000). Hasonló proteáz kaszkádok vesznek részt fejlődési folyamatokban, az extracelluláris mátrix remodelling folyamatában, a differenciálódásban és a sebgyógyulásban is (LeMosy és mtsi. 1999; Selvarajan és mtsi. 2001; Van den Steen és mtsi. 2001). A sokféle betöltött fiziológiai szerep az S1 családba tartozó szerin proteázok specificitásának nagyfokú változatosságára utal. A továbbiakban a szerin proteázok szerkezeti és katalitikus sajátosságait az S1 családba tartozó enzimek, illetve döntően a tripszin példáján mutatom be. 1.2 Az S1 családba tartozó szerin proteázok térszerkezete Az S1 családba sorolható szerin proteázok katalitikus doménje két, egymásra merőleges β-hordóból áll, melyeket hat antiparalell β-szál és egy C-terminális α-hélix épít fel (1. ábra). Feltételezések szerint a két hordóból álló szerkezet génduplikációs és fúziós események következében alakult ki, az ősi szerin proteáz gén csak egyetlen β-hordót kódolt (Lesk és Fordham 1996). Az enzim aktív helye a két hordó között helyezkedik el. A proteáz domén mellett számos szerin proteáz N-terminális, szabályozó szereppel bíró doméneket is tartalmaz (pl. kringle, epidermális növekedési faktor szerű (EGF), apple, cisztein-gazdag domén). A többdoménes szerkezet kialakulását az ősi proteáz domént kódoló gén 5 végén található 1-es fázisú exon-intron határ tette lehetővé, mely az S1 család számos proteázának génjében megőrződött (Patthy 1993). A proteáz domén katalitikus triád (vagy diád), szubsztrát-felismerő és zimogén aktivációs domén részekre tagolható (Kraut 1977). Ezen régiók funkciói azonban nem függetlenek egymástól, hanem összetett módon egymásba fonódnak (Gráf 1995; Hedström 2002). 8

9 1. ábra A vad típusú humán tripszin 4 térszerkezete az 1h4w Protein Data Bank file alapján a PyMol programmal ábrázolva (DeLano 2002). Az ábrán jól látható a szerkezetet felépítő egymásra merőleges két β-hordó, a köztük húzódó árokban található az enzim aktív helye. A katalitikus triádot alkotó His57 1 -et, Asp102-t és Ser195-öt zöld színnel, az Arg193-at, amely a humán tripszin 4 nem-konvencionális tulajdonságaiért felelős, pirossal és a szubsztrátkötő zsebben elhelyezkedő benzamidint narancssárgával emeltem ki. A szubsztrátkötés és a katalízis szempontjából funkcionális aminosavak döntően a β-szálakat összekötő hurkokban helyezkednek el. Az S1-specificitási zseb (Schechter-Berger nomenklatúra (Schechter és Berger 1967)), melyet három β-szál épít fel ( , , as aminosavak) és az oxianion lyuk (Gly193 és Ser195) is a C-terminális β-hordóhoz tartozik. 1.3 A katalitikus triád Az enzimatikus aktivitáshoz elengedhetetlen aminosavak, a His57, Asp102 és a Ser195 szerkezetileg konzerváltak, és együttesen katalitikus triádnak nevezik őket (Huber 1978). A katalitikus triád egy kiterjedt hidrogén-híd hálózat része (Hedström 2002) amely megfigyelhető a proteáz fehérje inhibitorokkal és transition state 1 A dolgozatban a tripszin aminosavainak számozása a kimotripszinogén konvenciót követi (Shotton és Hartley 1970). 9

10 analógokkal alkotott komplexeiben, illetve az acil-enzim komplexben is, ami arra utal, hogy ezek a hidrogén hidak jelen vannak a teljes katalitikus ciklus során. A katalitikus triád fontosságát kémiai módosítások (pl. a Ser195 OH csoportjának eltávolítása, a His57 metilálása az Nε2-en) és irányított mutagenezis felhasználásával végzett tanulmányok bizonyítják. Tripszinben a Ser195 vagy a His57 alaninnal való helyettesítése a k cat /K m értékét ed részére csökkenti (Corey és Craik 1992). A katalitikus triád további tagjainak alaninra való cseréje nem okoz további aktivitásvesztést. Ebből az következik, hogy a Ser195 vagy a His57 szubsztitúciója elegendő a katalitikus triád teljes működésképtelenné tételéhez. Az Asp102 aszparaginra való cseréje tripszinben a k cat /K m értékét ed részére csökkenti neutrális ph-n (Craik és mtsi. 1987; Sprang és mtsi. 1987). Fontos azonban megjegyezni, hogy a proteázok katalitikus erejének nem kizárólagos forrása a katalitikus triád: ezek a működésképtelen katalitikus triáddal rendelkező mutánsok szor gyorsabban hidrolizálják a szubsztrátokat a nem-katalizált reakció sebességéhez képest (Carter és Wells 1988; Corey és Craik 1992). A megmaradó aktivitás arra utal, hogy az oxianion lyuk, a deszolvatáció és talán a szubsztrát kanonikus konformációja is jelentős mértékben hozzájárul a katalízishez. 1.4 Az oxianion lyuk Az oxianion lyuk egy pozitívan töltött zseb, melyet a Ser195 és a Gly193 peptidgerinc NH csoportjai alkotnak (Robertus és mtsi. 1972). Az oxianion lyuk a Ser195-ön keresztül szerkezetileg kapcsolt a katalitikus triádhoz és az Ile16-Asp194 sóhídhoz. Az oxianion lyuk egyik szerepe az, hogy polarizálja a hasadó amid vagy észter kötést, így a karbonil szénre történő nukleofil támadást elősegíti a részleges pozitív töltés (Whiting és Peticolas 1994). Másik funkciója a hasadó kötés hidrolízise során keletkező tetraéderes intermedierek stabilizálása hidrogén hidas kölcsönhatások által (Kraut 1977; Warshel és mtsi. 1989). Ezekben az interakciókban a Gly193 és a Ser195 amido csoportjai a proton donorok, és a keletkező oxianion intermedier az akceptor (Henderson 1970; Robertus és mtsi. 1972). Egy nemrégiben leírt, a tetraéderes intermedierek kristályszerkezetét elemző tanulmány szerint a Gly193 amid nitrogénje és a P1 aminosav α-amino csoportja között szintén kialakulhat egy hidrogén híd (Liu és mtsi. 2006), ám a Gly193 által kialakított hidrogén hidak közül ez utóbb említettnek áll 10

11 közelebb a geometriája az optimálishoz, ami felveti annak a lehetőségét, hogy ez utóbbi kölcsönhatás fontosabb az oxianion stabilizálásához. Annak ellenére, hogy az optimális átmeneti állapot (transition state) stabilizáláshoz a glicin messze a legmegfelelőbb aminosav a 193-as pozícióban, ismertek ritka példák, ahol ezt a pozíciót nem glicin foglalja el. A legalaposabban karakterizált ilyen enzim a humán tripszin 4 (Nyaruhucha és mtsi. 1997; Rinderknecht és mtsi. 1984; Wiegand és mtsi. 1993), melyben egy arginin található a 193-as pozícióban (1. ábra). 1.5 A katalitikus mechanizmus A peptidkötések hidrolízisekor a proteázoknak három akadályt kell leküzdeniük. (1) Az amid kötések igen stabilak az amid nitrogén karbonil felé való elektron donálása miatt. A proteázok általában az amidkötést a karbonil oxigén egy általános savval való kölcsönhatásával aktiválják, illetve torzíthatják is a peptidkötést. (2) A víz egy gyenge nukleofil, a proteázoknak tehát aktiválniuk kell a hidrolítikus vízmolekulát, általában egy általános bázis által. (3) Az aminok rossz távozó csoportok, így a proteázok protonálják az amint, mielőtt az leválik az enzim felszínéről. A peptidkötések hidrolízisének szerin proteázok általi katalízise iskolapéldája a transition state stabilizálásának, az általános sav-bázis katalízisnek és a kovalens katalízisnek. 11

12 2. ábra A szerin proteázok általánosan elfogadott katalitikus mechanizmusa a kimotripszin peptidhidrolízisén bemutatva. A reakciónak két fázisa van. Az acilezési fázisban (1-4. lépés) a kovalens acil-enzim intermedier kialakulása a peptidkötés elhasításához kapcsolt. A dezacilezési fázisban (5-8. lépés), amely lényegében az acilezés fordítottja (mely során egy vízmolekula helyettesíti a szubsztrát amin-komponensét), az enzim regenerálódik. (Berg (szerk.) ábrája alapján) A katalitikus ciklus első lépéseként az enzim megköti a szubsztrátot, kialakítva a nem-kovalens Michaelis komplexet. A katalitikus szerin hidroxil oxigénje nukleofil támadást intéz a hasadó kötés elektronhiányos karbonil szenére és egy kovalens kötés alakul ki. A His57 a nukleofil támadást általános bázisként segíti elő. A megtámadott szénatom koordinációja tetraéderessé válik, ezért ezt az állapotot első tetraéderes intermediernek (TI 1 ) nevezik. A keletkező His57-H + -t az Asp102-vel kialakított hidrogén híd, az oxianiont pedig az oxianion lyukkal kialakított hidrogén hidak stabilizálják. A következő lépésben a TI 1 elbomlik a C-terminális (első) terméket és az acil-enzimet eredményezve. A távozó csoport protonálását a His57-H + végzi általános savként szerepelve. Az acilezést a mechanizmusát tekintve hasonló dezacilezés követi, amely során az acil-észter kötést egy, ezt megelőzően a His57 által aktivált vízmolekula támadja meg (Bender és Kézdy 1965; Polgár és Bender 1969). A második tetraéderes intermedier elbomlása után a második termék is disszociál az enzim felszínéről, és az enzim regenerálódik. 12

13 1.6 Bizonyítékok a katalitikus mechanizmus érvényességére A fent leírt katalitikus mechanizmust számos kinetikai, illetve szerkezeti adat támasztja alá. Az acil-enzim intermedier létezésére elsőként a kimotripszin és a p-nitrofenil acetát reakciójának burst kinetikája utalt (Hartley és Kilby 1954). Ezt követően izoláltak acil-enzimeket a kimotripszin és számos észter reakciója során, és bizonyították ezen intermedier kinetikai, illetve kémiai kompetenciáját is (Hess és mtsi. 1970). Számos röntgen krisztallográfiás szerkezet is ismert acil-enzim intermedierekről, mint például a γ-kimotripszin és egy autoproteolítikus peptid komplexe (Dixon és mtsi. 1991; Dixon és Matthews 1989; Harel és mtsi. 1991). A peptid szerkezetét könnyen helyettesíteni lehet fehérje típusú inhibitorok szerkezetével, ami tovább erősíti az acil-enzim kompetens voltát a katalízis szempontjából. Ismert továbbá egy bakteriális proteáz egy peptiddel alkotott acil-enzim komplexének (Blanchard és James 1994), illetve az elasztáz egy heptapeptiddel, a β-kazomorfinnal alkotott acil-enzim komplexének szerkezete is (Wilmouth és mtsi. 1997; Wilmouth és mtsi. 2001). Ez utóbbi tanulmányok szerint az észterkötés planáris, és a karbonil csoport nem torzult a tetraéderes szerkezet irányába, mint ahogy azt korábban megfigyelték. Mivel a tetraéderes intermedier nem stabil, ennek megfelelően életideje is igen rövid, illetve egyéb technikai nehézségek miatt csak kisszámú olyan kristályszerkezet áll rendelkezésre, amelyben valóban a tetraéderes intermedier állapot figyelhető meg (Liu és mtsi. 2006; Wilmouth és mtsi. 2001). A Michaelis komplex szerkezetének ismeretében az acil-enzim és egy tetraéderes intermedier analóg atomi felbontású szerkezetének analízise révén ma már az aktív hely finomszerkezetének változásait és a hidrolítikus víz támadási útvonalát is ismerjük a szarvasmarha tripszin esetében (Radisky és mtsi. 2006). Felmerül a kérdés azonban, hogy olyan szerin proteázokban, ahol természetesen előforduló mutációk következtében az oxianion lyuk egyik eleme, a 193-as pozíciójú aminosav nem glicin (ilyen az általam vizsgált humán tripszin 4 is), a konvencionális tripszinekhez (pl. szarvasmarha tripszin, kimotripszin) képest eltérő-e az egyes reakció intermedierek szerkezete, vagy az egyes reakciólépések termodinamikája (ld. 5.4 fejezet). 13

14 1.7 A szubsztrátfelismerő-hely és a szubsztrátspecificitást meghatározó tényezők A szubsztrátfelismerő-hely magába foglalja a polipeptidkötő helyet és a peptidszubsztrát oldalláncait befogadó kötőzsebeket. A proteázok specificitására irányuló tanulmányok általában a P1/S1 kölcsönhatásra fókuszálnak, amit a P2-Pn/S2- Sn kölcsönhatások figyelembe vétele követ (Schechter-Berger nomenklatúra (Schechter és Berger 1967)). A P1-P1 a hasadó kötés acil és távozó csoport oldalán található aminosavakat jelöli a szubsztrátban. A szomszédos aminosavakat a hasadó kötéstől távolodva növekvő számok jelölik, és az S1, S1 stb. a megfelelő kötőhelyeket jelöli az enzim felületén. Az S1 -Sn helyeket általában figyelmen kívül hagyják a specificitásvizsgálatoknál a kromofór távozó csoporttal rendelkező szubsztrátok gyakori használata miatt. A következőkben röviden összefoglalva külön tárgyalom az S1 hely, a polipeptidkötő hely, az S2-Sn és S1 -Sn helyek szerepét a szubsztrát felismerésében és a specificitásban Az S1 hely Az S1 családba tartozó szerin proteázok specificitását általában a P1-S1 kölcsönhatással kapcsolatban osztályozzák. Az S1 hely a Ser195-tel szomszédos zseb, melyet a , és as aminosavak alkotnak. A P1 specificitást általában a 189-es, 216-os és a 226-os pozícióban elhelyezkedő aminosavak határozzák meg (a témáról írt összefoglaló tanulmányok: (Czapinska és Otlewski 1999; Perona és Craik 1995) Az Asp189, a Gly216 és a Gly226 egy negatívan töltött S1 zsebet alakít ki, ami magyarázza a tripszin preferenciáját a P1 helyen arginint vagy lizint tartalmazó szubsztrátok felé (Huber és mtsi. 1974; Krieger és mtsi. 1974). A tripszin, a kimotripszin, az elasztáz és a granzim B ezen pozícióit elfoglaló aminosavakat és az említett enzimek specificitását összevetve úgy tűnhet, hogy ezen proteázok specificitását mindössze néhány szerkezeti elem kontrollálja. Azonban a fent említett szerkezeti elemek egyszerű áthelyezése nem kapcsolja át az S1 specificitást (Gráf és mtsi. 1988; Hedström és mtsi. 1992; Hedström 1996), melynek oka többek között az S1 zseb és az aktivációs domén deformációja az S1 zseb-mutáns enzimekben. 14

15 1.7.2 A polipeptidkötő hely A proteáz-szubsztrát kölcsönhatások túlterjednek az S1 helyen, érintve a polipeptidkötő helyet és gyakran további kötőzsebeket is. A polipeptidkötő hely a os aminosav főlánca, mely antiparalell β-lemezt képez a peptid szubsztrát P1-P3 aminosavainak peptidgerincével. Kimotripszinben hidrogén hidak alakulnak ki a Ser214 karbonil oxigénje és a P1 aminosav NH csoportja, a Trp215 NH csoportja és a P3 aminosav karbonil csoportja illetve a Gly216 karbonil csoportja és a P3 aminosav NH csoportja között. Ezek a kölcsönhatások általánosan jellemzők a kimotripszin-szerű szerin proteázokra, és fontos szerepet játszhatnak a hatékony szubsztráthidrolízisben, bár ezen hidrogén hidas kölcsönhatások megszüntetésének csak kis hatása van a szubsztrát hidrolízisére (Coombs és mtsi. 1999). A os aminosavak részt vesznek az S1 zseb egyik falának kialakításában is, a Ser214 karbonil csoportja pedig hidrogén hidas kapcsolatban áll a His57-tel. Ezek a szerkezeti kölcsönhatások kommunikációs útvonalat képeznek a polipeptidkötő hely, az S1 hely és a katalitikus triád között. A fehérje típusú szerin proteáz inhibitorok inhibíciós hurokja kinyújtott, úgynevezett kanonikus konformációban rögzített, ami szükséges az inhibitor és a polipeptidkötő hely közötti antiparalell β-lemez kialakításához. A β-lemezes szerkezet következtében a peptidszubsztrát szomszédos oldalláncai alternáló irányba mutatnak. A polipeptid szubsztrátok valószínűleg szintén kanonikus konformációt vesznek fel az enzimhez való kötődéskor, amelyet acil-enzim intermedierek térszerkezetének elemzése is alátámaszt (Katona és mtsi. 2002b; Liu és mtsi. 2006; Radisky és mtsi. 2006) Az S2-Sn helyek Kimotripszinben az S2-S3 helyek kis szubsztrát-diszkriminációt mutatnak (Schellenberger és mtsi. 1991). Az S2 hely egy sekély hidrofób árok, melyet a His57, a Trp215 és a Leu99 határol; az S2 hely specificitása korrelál a P2 oldallánc hidrofobicitásával (Brady és Abeles 1990). Mivel a P3 aminosav oldallánca túlnyúlik az aktív hely hasadékán, az S3 hely csak kismértékben járul hozzá a specificitáshoz. Az aktív helyet körülvevő hurkokat érintő inzerciók jobban definiált zsebeket hoznak létre az S2-Sn helyeken egyéb szerin proteázokban. Ezek a helyek a specificitás fő 15

16 meghatározói lehetnek (Bode és mtsi. 1992), mint például az elasztáz (Stein és mtsi. 1987) és az enterokináz esetén (Lu és mtsi. 1999) Az S1 -S3 helyek A távozó csoport S1 -Sn helyekkel való kölcsönhatásaira általában fehérje inhibitorokkal alkotott komplexek szerkezetéből következtetnek, amelyekben nem a szubsztráthasítási kísérletekben optimálisnak bizonyult P1 -Pn aminosavak találhatók, ezért a P oldalláncok pontos kölcsönhatásai nem ismertek. A P2 aminosav főlánc NH csoportja és a Phe41 főlánc karbonil oxigénje között kialakuló hidrogén híd a P /S kölcsönhatások egy állandó jellemzője. A kimotripszin a P1 helyen arginint vagy lizint tartalmazó szubsztrátokat preferálja, ami az Asp35-tel és az Asp64-el kialakított elektrosztatikus kölcsönhatásoknak tulajdonítható (Schellenberger és mtsi. 1994). A szubsztrát β-lemezzel való illeszkedése következtében a P1 és P3 oldalláncok azonos irányba mutatnak, így az S1 és S3 helyek átfednek egymással. Az S1 /S3 helyet határoló hurkokat érintő inzerciók szintén létrehozhatnak jobban definiált S1 -S3 kötőhelyeket (Bode és mtsi. 1992). 1.8 A szerin proteázok aktivációja A kimotripszin-szerű szerin proteázok inaktív zimogén formában szintetizálódnak. A zimogének az aktivációs peptid proteolítikus hasítása révén aktiválódnak. Az újonnan kialakult N-terminális, az Ile16 -amino csoportja stabilizáló sóhidat képez az Asp194 oldallánc karboxil csoportjával, amely előidézi az aktív enzimhez vezető konformációváltozást (Birktoft és mtsi. 1976; Huber 1978; Kossiakoff és mtsi. 1977). Ez a szerkezeti átrendeződés a fehérje egy jól körülhatárolt régióját érinti, amely a molekula 15%-át teszi ki, míg a zimogén és az aktív enzim szerkezetének 85%-a azonos (3. ábra). 16

17 3. ábra A szarvasmarha tripszinogén (1tgn) és a humán tripszin 4 (1h4w) egymásra illesztett szerkezete a DeepView-spdv 3.7 programmal (Guex és Peitsch 1997) ábrázolva. A humán tripszin 4 aktivációs doménnek megfelelő peptidszegmense, melynek konformációja eltér a szarvasmarha tripszinogén szerkezetétől (szürke), kék szalagként van kiemelve. Zölddel jelöltük a 193-as aminosav peptidgerincét, amely nagy szögváltozásokon megy keresztül az aktiváció során. A Trp141-et, Trp215-öt és Trp221-et, melyek felelősek lehetnek a konformációváltozás során bekövetkező fluoreszcencia intenzitás változásért (ld illetve 5.5 fejezet), piros színnel jelöltük, míg a Trp51 és a Trp237 sárga színű. Az aktiváció során négy peptidszegmens megy keresztül konformációs átrendeződésen: a es szegmens, a es szegmens (az autolízis hurok), a es és as szegmens (ez utóbbi kettő alkotja a szubsztrátkötő zsebet és az oxianion lyukat), melyeket együttesen aktivációs doménnek neveznek (Huber 1978). A konformációváltozás révén válik teljessé a szubsztrátkötő zseb és az oxianon lyuk kialakulása (Bode és mtsi. 1978; Fehlhammer és mtsi. 1977). Az aktiváció során bekövetkező konformációváltozás az aktív konformációjú szerkezetet stabilizáló sóhíd perturbálása révén előidézhető 11,0-esről 8,0-as ph-ra való ph-ugrással is (Fersht és Renard 1974; Heremans és Heremans 1989; Stoesz és Lumry 1978), és követhető az enzim belső fluoreszcenciájának mérésével (Verheyden és mtsi. 2004), amely egy elegáns kísérleti megközelítést nyújt a szerkezeti átrendeződés tanulmányozására (ld illetve 5.5 fejezet). Kimotripszin esetén leírták, hogy a ph-ugrásos módszerrel mért sebességi állandó megegyezik a proflavin kötési tanulmányokból nyert adattal (Fersht és Requena 1971; Verheyden és mtsi. 2004). 17

18 A tripszinogén-tripszin átmenet irányított molekuladinamikai szimulációja (targeted molecular dynamics simulations) azt mutatta, hogy a főláncban a legnagyobb szögváltozások bizonyos glicineknél történnek, melyek közül a Gly19, Gly142, Gly184, Gly193 és a Gly216 határol aktivációs domén peptidet (Brünger és mtsi. 1987). Ezek a glicinek nagyobb Φ és/vagy Ψ szögváltozásokat mutatnak, mint a környező aminosavak. Ez arra utal, hogy ezek a glicinek jól definiált szereppel rendelkeznek: csuklóként működnek a konformációváltozás során, míg a négy peptidszegmens merevebb egységként mozog (Brünger és mtsi. 1987; Mátrai és mtsi. 2004). A glicinek jelenléte az aktivációs domén konzervált pozícióiban elősegíteni látszik a konformációs átmenetet. Ennek következményeképpen az egyik csukló aminosav, a Gly193 helyettesítése egy olyan aminosavval, mely terjedelmes és/vagy töltött oldallánccal rendelkezik (pl. az Arg193 a vad típusú humán tripszin 4-ben), feltehetőleg szignifikáns hatással van az aktiváció során bekövetkező konformációváltozás sebességére és termodinamikájára (ld. 5.5 fejezet). Molekuladinamikai és irányított molekuladinamikai szimulációk alapján levezették az aktiváció legfontosabb al-lépéseinek sorrendjét szarvasmarha és patkány kimotripszinogénben (Mátrai és mtsi. 2004; Wroblowski és mtsi. 1997). Mátrai és munkatársai leírták a Gly193 szerepét is az események sorozatában. A 192-es pozícióban a peptidgerinc konformációváltozása idézi elő a Gly193 szubsztrátkötő zseb felé való orientálódását és az Asp194 ~180 -al való elfordulását a C -C kötés körül. Ennek eredményeképpen egy üreg keletkezik a molekulában, ami szükséges ahhoz, hogy az Ile16 behatolhasson a molekula belsejébe, és lehetővé teszi az Ile16 és az Asp194 között a sóhíd kialakulását. Az események sorozata a hatékony enzimatikus aktivitáshoz szükséges szubsztrátkötő zsebbel és oxianion lyukkal rendelkező aktív enzimkonformáció kialakulásához vezet. A szerin proteázok aktivációjának eseményei tehát jól ismertek, azonban tisztázatlan, hogy milyen kinetikai, illetve termodinamikai következményei vannak a csukló régiók merevebbé tételének, a konformációs szabadság korlátozásának a csukló-glicinek kiterjedtebb oldalláncú aminosavra való cseréje által. Dolgozatomban erre a kérdésre is próbáltam választ találni (ld. 5.5 fejezet). 18

19 1.9 A humán tripszin 4 irodalmi áttekintése A humán tripszinogén 4 genomikai és transzkriptomikai tulajdonságairól, az enzim inhibitorokkal szembeni viselkedéséről, szubsztrátspecificitásáról és potenciális funkciójáról rendelkezésre álló információkat Szepessy és Sahin-Tóth kitűnő összefoglaló közleményének (Szepessy és Sahin-Tóth 2005) gondolatmenetét követve rendszereztem A humán tripszinogén 4 felfedezése 1978-ban Rinderknecht és munkatársai a mezotripszint 2 a humán hasnyálmirigy szövetben és hasnyálmirigy folyadékban kis mennyiségben megtalálható, inhibitor rezisztens tripszinként azonosították (Rinderknecht és mtsi. 1978). A humán hasnyálmirigy által szekretált tripszinogének döntő többségét két izoforma adja, melyeket izoelektromos pontjuk után kationos tripszinogénnek (pi = 6,2-6,4) (más néven humán tripszinogén 1) és anionos tripszinogénnek (pi = 4,4-4,9) (humán tripszinogén 2) neveznek (Scheele és mtsi. 1981). A Rinderknecht által felfedezett harmadik tripszinogén izoformát mezotripszinogénnek nevezik a fentebb említett két izoforma közé eső elektroforetikus mobilitása alapján (pi = 5,5-5,7) (Rinderknecht és mtsi. 1979; Rinderknecht és mtsi. 1984) A PRSS3 gén genomi elhelyezkedése és szerkezete A humán β T-sejt receptor (TCR) elemeket kódoló gének a 7-es kromoszóma q35-ös régiójában helyezkednek el. A régió analízise kimutatta, hogy a lókuszban két különböző típusú kódoló elem található: TCR elemek és nyolc tripszinogén gén (Hood és mtsi. 1995; Rowen és mtsi. 1996). Ezek közül három kódol funkcionális 2 Az irodalomban zavaró módon többféle elnevezése is használatos a PRSS3 gén által kódolt fehérje alternatív variánsainak. A mezotripszinogén, humán tripszinogén 3 és humán tripszinogén 4 C izoforma megjelölések ugyanazt a fehérjét jelölik (ld és fejezet). A fehérje alternatív variánsainak aktiválódása után a proteáz domén szekvenciája már azonos, amit nevezhetünk mezotripszinnek, humán tripszin 3-nak vagy humán tripszin 4-nek is. A dolgozatban a humán tripszinogén 4 A, B és C izoforma illetve humán tripszin 4 megnevezéseket használom. 19

20 tripszinogént, ezekhez képest fordított transzkripciós irányban pedig kettő pszeudogén és egy reliktum gén található. A tripszinogén gének a β T-sejt receptor V β és D β elemei közé ékelődve helyezkednek el a régióban, és öt exonból épülnek fel. Ebben a régióban található a PRSS1, mely a humán tripszinogén 1-et kódolja és a PRSS2, mely a humán tripszinogén 2-t kódolja. A régióban megtalálható harmadik, szerkezete alapján funkcionális tripszinogén gén valószínűleg kis mennyiségben a thymusban expresszálódik. A tripszinogén gének β lókuszba való interkalálódása konzervált módon megtalálható egérben (Hood és mtsi. 1995) és csirkében is (Wang és mtsi. 1995), ami utalhat közös funkcionális vagy szabályozási kontrollra. A mezotripszinogént kódoló gén, a PRSS3 szoros rokonságot mutat a két fentebb említett tripszinogén génnel, azonban genomi lokalizációja eltér ezekétől. A PRSS3 a 9-es kromoszóma p13-as régiójában helyezkedik el, és 7-es, illetve 11-es kromoszóma eredetű DNS szakaszokat is tartalmaz (4. ábra). A β TCR lókusz 3 végéről származó, egy funkcionális tripszinogén gént és legalább hét V β elemet magába foglaló DNS szegmens duplikálódott majd transzlokálódott a 7-es kromoszómáról a 9-es kromoszómára (Hood és mtsi. 1995; Rowen és mtsi. 1996). A 11-es kromoszóma q24-es régiójából származó DNS szakasz a LOC lókusz nem-kódoló első exonjából származik. Ez a lókusz egy erősen konzervált, ismeretlen funkciójú transzmembrán fehérjét kódol A humán tripszinogén 4 mrns alternatív variánsai A fent leírt génduplikációs és transzlokációs események következtében a PRSS3 mrns-ek kétféle első exonnal rendelkezhetnek, ami lehetőséget ad a fehérje alternatív variánsainak keletkezésére (4. ábra). Háromféle humán tripszinogén 4 izoforma (A, B és C izoforma a SwissProt adatbázisban) kialakulása prediktálható, melyek másodikötödik exonja azonos, de első exonjuk különböző, így N-terminális szekvenciájukban eltérnek egymástól (5. ábra). A C izoformával szemben, a másik két variáns fúziós mrns, amelyről a humán tripszinogén 4 A és B izoformája keletkezhet. A humán tripszinogén 4 A és B izoformájának első exonja a 11-es kromoszómáról transzlokálódott LOC lókusz nem-kódoló első exonjából származik. Az alternatív splicing során e szekvencia és a humán tripszinogén 4 második-ötödik exonja, amely az aktivációs peptidet és az aktív enzimet kódolja, fuzionál egymással. Ezek az izoformák egyetlen közös génről átíródó mrns szövetspecifikus alternatív splicingja 20

21 és/vagy alternatív promóter használat révén alakulnak ki: a C izoforma a hasnyálmirigyben, míg (az A és) a B izoforma az agyban és epitheliális eredetű sejtekben expresszálódik (Cottrell és mtsi. 2004; Wiegand és mtsi.1993). Az A izoforma esetén a zárójel használatát az indokolja, hogy transzkripcióját egyetlen EST szekvencia bizonyítja, a fehérje expresszióját pedig ezidáig nem tudták igazolni (ld , fejezet). 4. ábra A humán tripszinogén 4 három izoformájának kialakulása. Mindhárom izoformát a 9-es kromoszómán elhelyezkedő PRSS3 gén kódolja. A három izoforma második-ötödik exonja (az ábrán lilával jelölve), mely az aktivációs peptidet és az aktív enzimet kódolja, azonos. Szövetspecifikus alternatív splicing és/vagy alternatív promóter használat révén az A és a B izoforma első exonja eltérő lesz a C izoformáétól (piros illetve zöld színnel jelölve), ennek következtében más karakterű N-terminális peptiddel rendelkeznek. A B izoforma az A izoformából származtatható egy belső CUG kodonról induló alternatív transzláció iniciációval A humán tripszinogén 4 izoformáinak N-terminális szekvenciája A C izoformát nevezték eredetileg mezotripszinogénnek, amely hasonlóan a legtöbb szerin proteázhoz, a szekretált fehérjékre jellemző, a fehérjét az endoplazmatikus retikulum (ER) lumenébe irányító tipikus eukarióta szignálszekvenciát hordoz (Nelson (szerk.) 1998; von Heijne 1986). A szignálszekvencia hossza általában aminosav (tripszinogének esetében általában 15 aminosav), és a következő 21

22 tulajdonságok jellemzik: tartalmaz hidrofób oldalláncú aminosavat, az N- terminálishoz közel egy vagy több pozitívan töltött oldalláncú aminosav található, amelyet hidrofób és kisméretű nem-töltött oldalláncú aminosavak követnek, tartalmazza az Ala-Val-Ala szekvenciát követő β-kanyart és a szignál peptidáz hasítóhelyet (Nelson (szerk) 2005; von Heijne 1986). A szignálszekvenciát a szignál peptidáz hasítja le a fehérjéről az ER lumenében. Ebben a kompartmentben a redoxpotenciál viszonyok lehetővé teszik a fehérje szerkezetét stabilizáló diszulfid hidak kialakulását. Innen a fehérje transzport vezikulumokban a Golgi komplexbe kerül, majd szekréciós granulumokon át kerül szekrécióra. A izoforma B izoforma C izoforma MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAAR ?ELHPLLGGRTWRAAR MNP A izoforma B izoforma C izoforma DADGCEALGTVAVPFDDDDK DADGCEALGTVAVPFDDDDK FLILAFVGAAVAVPFDDDDK 5. ábra A humán tripszinogén 4 három izoformájának N-terminális aminosav szekvenciája a proteáz domén határáig. A neutrális ph-n pozitívan töltött aminosavakat (Lys, Arg, His) lilával, a negatívan töltött aminosavakat (Asp, Glu) pirossal jelöltem. Szembetűnő, hogy a C izoforma szignál szekvenciájához képest, amely kiterjedt hidrofób maggal rendelkezik, az A és B izoforma számos töltött aminosavat tartalmaz. A DDDDK szekvencia az enterokináz felismerőhelye. A kérdőjel arra az ellentmondásra utal, hogy a B izoforma genomi szekvenciák alapján prediktált kezdő aminosava metionin, míg az izolált fehérje leucin iniciátor aminosavval rendelkezik (ld. 5.1 fejezet). A humán tripszinogén 4 A és B izoformákból hiányzik a szekretált fehérjékre jellemző szignálszekvencia, az első exon által kódolt N-terminális peptidjük számos töltéssel rendelkező aminosav oldallánccal rendelkezik (5. ábra). A genomi szekvenciából prediktált A izoforma esetén a transzláció a -44-es pozíciójú AUG kodonról indul, és a fehérje egy 72 tagú, számos töltéssel rendelkező oldalláncú aminosavat tartalmazó N-terminális peptiddel rendelkezik. A B izoforma az A izoformából származtatható a +1-es pozíciójú CUG kodonról induló alternatív transzláció iniciációval, melynek következtében egy rövidebb, 28 tagú N-terminális peptidet hordoz. A nem-aug kodonról induló transzláció iniciácó jelenségét néhány eukarióta és virális fehérje esetén már leírták (Acland és mtsi. 1990; Kozak 1991a; Kozak 1991b; Nagpal és mtsi. 1992). Az alternatív transzláció iniciáció szekvenciális feltételeit és mechanizmusát az fejezetben tárgyalom. 22

23 A humán tripszinogén 4 N-terminális peptidjében három Arg-X-X-Arg peptidmotívum található, amely a membrán-asszociált Ca-függő furin szerin endopeptidáz felismerőhelye (Bresnahan és mtsi. 1990; Molloy és mtsi. 1992). A processzáló enzim a konszenzus szekvencia C-terminálisán bekövetkező hasítást sejten belüli kompartmentekben és sejten kívül is katalizálja. A furin által processzált prekurzor fehérjék mind szekretált fehérjék. Bár nem zárható ki egy további humán tripszinogén 4 exon megléte, amely egy ilyen szignálpeptidet kódolna, sem Wiegand és munkatársai (Wiegand és mtsi. 1993), sem a munkánk során kutatócsoportunk nem tudta kimutatni az ennek megfelelő mrns-t. A humán tripszinogén 4 esetleges szekrécióra kerülésére utaló egyetlen jel az, hogy immunhisztokémiai módszereket használva transzfektált és a fehérjét endogén módon termelő epitheliális sejtekben a fehérje vezikulumokként azonosított organellumokkal való asszociáltságát figyelték meg. A szignálszekvencia hiányával összhangban a fehérje szekrécióját nem tudták kimutatni ezekben a sejtvonalakban (Cottrell és mtsi. 2004). A diszulfid hidak kialakulása szempontjából fontos kérdés a fehérje lokalizációja és transzportja a sejten belül, amely eddig még tisztázatlan Transzláció iniciáció nem-aug kodonokról Eukarióták transzláció iniciációja során a riboszóma kis (40S) alegysége, a MettRNSi és az eif2-gtp komplex általában az mrns 5 végén kötődik meg és végigtapogatja az 5 nem-transzlálódó régiót az első AUG kodonig. Az eukarióta mrns-ek körülbelül 10%-a nem az első AUG-ről kezdődően transzlálódik, amennyiben az nem kedvező szekvenciális környezetben helyezkedik el, hanem a transzláció a második, vagy akármelyik másik 3 irányban elhelyezkedő AUG kodonról indul. Továbbá létezik néhány olyan jól demonstrált eset is, ahol a transzláció az mrns-ben az első AUG kodont megelőző vagy azt követő nem-aug kodonról indul (Cigan és mtsi. 1988; Kozak 1997; Peabody 1989). Eukariótákban a nem-aug kodonról induló transzláció iniciációt elsőként virális gének esetében írták le (Becerra és mtsi. 1985), de ismertek példák proto-onkogének, transzkripciós faktor kináz és növekedési faktor gének körében is (Acland és mtsi. 1990; Hann és mtsi. 1988; Saris és mtsi. 1991; Touriol és mtsi. 2003). Sokáig azt gondolták, hogy az iniciátor kodon milyenségétől függetlenül metionin az iniciátor aminosav, és abban a néhány esetben, 23

24 ahol nem metionin a kezdő aminosav, a virális gén tartalmaz a nem-konvencionális start kodontól 5 irányban egy belső riboszóma bekötési helyet (internal ribosome entry site) (Sasaki és Nakashima 2000; Wilson és mtsi. 2000). Nemrégiben azonban Schwab és munkatársai bebizonyították, hogy a leucin is transzlálódhat iniciátor aminosavként CUG kodonról antigén prezentáló sejtek által szintetizált rövid, rejtélyes peptidekben (Schwab és mtsi. 2003; Schwab és mtsi. 2004). Ebben az esetben a leucin start nem függ belső riboszóma kötő hely-szerű mrns struktúrától, és a transzláció hatékonyságát a konszenzus Kozak szekvenciától való enyhe eltérés fokozza (Kozak 1986). A transzláció iniciációja nem-aug kodonoknál egy meghatározott konszenzus szekvenciát igényel, amelyben különösen a -3-as (A vagy G) és a +4-es (G) pozíciójú nukleotidok fontosak az iniciátor kodontól 3 irányban elhelyezkedő régiók másodlagos szerkezet kialakítására képes szekvenciája mellett (Kozak 1991b). A humán tripszinogén 4 mrns-ben a -3-as és a +4-es pozíciót is guanin foglalja el, így a belső CUG kodonról induló transzláció iniciáció ismert előfeltételei teljesülnek. Tanszékünkön jelenleg is folyamatban lévő ezirányú kísérletek eredményei azt mutatják, hogy a humán tripszinogén 4 B izoformájának CUG kodonról induló transzláció iniciációja során szintén leucin az első beépülő aminosav (ld. 5.1 fejezet) A humán tripszinogén 4 izoformáinak transzkripciója A C izoformának megfelelő cdns-t először 1990-ben klónozták meg (Tani és mtsi. 1990), bár a közölt szekvencia tartalmaz néhány hibát. A korrekt cdns szekvenciát 1993-ban és 1997-ben írták le (Nyaruhucha és mtsi. 1997; Wiegand és mtsi. 1993). A C izoforma a hasnyálmirigyben termelődik (Nyaruhucha és mtsi. 1997; Rinderknecht és mtsi. 1984; Tani és mtsi. 1990). A C izoforma mrns-ének létezését és pankreatikus előfordulását számos EST klón is bizonyítja (Rowen és mtsi. 2005). Az A és B izoformák transzkripcióját több munkacsoport is vizsgálta, olyan oligonukleotidok segítségével, amely az A és a B izoformát is amplifikálják. Ezen eredmények alapján a B izoforma (illetve mindkét izoforma) a központi idegrendszerben kerül transzkripcióra (Tóth és mtsi. 2006b; Wiegand és mtsi. 1993), termelődését kimutatták prosztata, vastagbél és légúti eredetű epitheliális sejtvonalakban, illetve normál vastagbél nyálkahártyában is (Cottrell és mtsi. 2004). A B izoformának megfelelő EST szekvenciákat klónoztak különböző agyi régiókból, 24

25 szívből, méhből és számos tumoros sejtvonalból is (Rowen és mtsi. 2005). Az A izoformának megfelelő mrns agyszövetből azonban nem volt kimutatható (Wiegand és mtsi. 1993). A hosszabb mrns hiányát magyarázhatja RNS degradáció, illetve az, hogy a transzkripció elindul egy belső CUG kodontól 5 irányban lévő négy GCpromóter valamelyikéről. Az A izoformának megfelelő mrns létezését egyetlen EST szekvencia (BI823946) bizonyítja, melyet egy agyból, tüdőből és heréből izolált mrns készlet keverékből klónoztak, azonban a fehérje expressziójára nincs bizonyíték A humán tripszinogén 4 izoformáinak expressziója Fehérje szinten a C izoformát gélelektroforézissel izolálták hasnyálmirigyből, és leírták, hogy expressziós szintje a normál pankreatikus folyadékban az össztripszinogén tartalom 3-10%-a (Rinderknecht és mtsi. 1979; Rinderknecht és mtsi. 1984; Rinderknecht és mtsi. 1985; Scheele és mtsi. 1981). Krónikus alkoholisták hasnyálmirigy folyadékában megemelkedett mezotripszinogén szintet találtak (Rinderknecht és mtsi. 1979; Rinderknecht és mtsi. 1985), míg krónikus pankreatitisz esetén csökkent fehérjeszintet írtak le (Rinderknecht és mtsi. 1979). A humán tripszinogén 4 fehérjét immunfestéssel mutatták ki PC-3 és SW480 epitheliális sejtvonalakban (Cottrell és mtsi. 2004). Mivel a munkához egy, a proteáz domént felismerő monoklonális anti-tripszin ellenanyagot használtak, ami feltételezhetőleg minden tripszin izoformával reagál, nem lehet megmondani, hogy az ilyen módon kimutatott reaktivitás a fehérje A vagy B izoformájának felel-e meg. Kutatócsoportunkban Siklódi Erika vizsgálta a fehérje eloszlását immunprecipitációval kombinált szendvics ELISA módszerrel a humán agy különböző területeiről származó mintákban (Tóth és mtsi. 2006b). Az immunprecipitáció során az antigének agyi extraktumokból való izolálásához a proteáz domént és a 28 aminosavas N-terminális peptidet felismerő monoklonális ellenanyagokat is használt, melynek révén a zimogén és az aktív enzim mennyiségét külön tudta mérni. A humán tripszinogén/tripszin 4 mennyisége a mintákban ng/g nedves szövet volt. Hét agyterületben (frontopolaris cortex, occipitális cortex, hypothalamus, putamen, thalamus, periaqueductális szürkeállomány és nyaki gerincvelő) a teljes mennyiség (zimogén + aktív enzim) nagyjából megegyezett a zimogén mennyiségével, míg a többi agyterületről származó mintákban (bulbus olfactorius, cingulate cortex, somatomotoros 25

26 cortex, kérgi fehérállomány, hippocampus, substantia nigra, pons, kisagyi kéreg, cerebellaris fehérállomány és nyúltvelő) a zimogén mennyisége jelentősen kisebb volt a teljes mennyiségnél. Ezekből az adatokból arra következtetünk, hogy az aktiváció mértéke függ az adott agyterülettől. A legnagyobb mértékű aktivációt kisagyi kéreg, nyúltvelő és hippocampus mintákban találtuk. A fehérje relatíve magas szintje az agykérgi és kisagyi fehérállomány mintákban arra utal, hogy ez a proteáz gliális elemekben expresszálódik. Kutatócsoportunkban Dr. Medveczky Péter immunhisztokémiai vizsgálatai valóban azt mutatták, hogy a fehérje gliasejtekben és neuronok sejtmag körüli régiójában lokalizálódik (Gráf és Szilágyi 2003; Tóth és mtsi. 2006b). A humán tripszinogén 4 immunreaktivitás lokalizálásához anti-proteáz domén és a 28 aminosavból álló N-terminális peptidet felismerő monoklonális ellenanyagokat használtunk. A gerincvelő szarvaiban erős immunreaktivitást találtunk a gliasejtekben. Az immunfestett sejtek alakja, mérete és eloszlása megegyező volt alternáló metszetek GFAP-festett (gliális fibrilláris savas protein) sejtjeinek jellegével, utalva arra, hogy a gerincvelő fehérállományában az immunpozitív sejtek nagy valószínűséggel asztrociták. Neuronális sejtek a gerincvelő mellső szarvában és központi szürkeállományában szintén mutattak festődést az anti-humán tripszin 4 ellenanyagokkal, de nem reagáltak az anti-gfap ellenanyagokkal. Humán tripszinogén 4 immunpozitív gliasejtek és rostok voltak megfigyelhetők kérgi fehérállományban (frontális kéreg) és a kéreg III-as, IV-es és V-ös rétegének neuronális sejtjeiben is. A gerincvelőhöz hasonlóan, a gliális sejteket egyformán festette az anti-humán tripszinogén 4 és az anti-gfap ellenanyag, de a sejtek az N-terminális peptidet felismerő ellenanyaggal nem reagáltak A humán tripszin 4 általános jellemzői A humán tripszinogén 4 nagyfokú homológiát mutat a korábban leírt humán tripszinogén izoformákkal: aminosav szekvenciája 86%-ban azonos a humán tripszinogén 1-ével és 88%-ban azonos a humán tripszinogén 2-ével (Nyaruhucha és mtsi. 1997). Az izolált cdns alapján a fehérje aminosav szekvenciájára jellemzőek a szerin proteázok S1 családjának főbb tulajdonságai. A humán tripszinogén 4 rendelkezik az Asp11-Asp14 polianinos csoporttal, melyet az aktivációs hasítóhely (Lys15-Ile16) követ. Az aktív enzim tíz, konzervált pozíciójú (Emi és mtsi. 1986) 26

27 ciszteint tartalmaz, amelyek öt diszulfid hidat alakítanak ki. A szerin proteázok aktív centrumát képző His57, Asp102, Ser195 katalitikus triád szintén megtalálható a molekulában. A 189-es pozícióban Asp, a 216-os és a 226-os pozícióban pedig glicin található, amely pozícióknak a szubsztrátspecificitás meghatározásában van szerepük (Craik és mtsi. 1985) A humán tripszin 4 térszerkezete A humán tripszin 4 benzamidinnel alkotott komplexének térszerkezetét 2002-ben Katona Gergely oldotta meg (Katona és mtsi. 2002a) (1. ábra). Az 1,7 Å felbontású szerkezet elemzése megmutatta, hogy a humán tripszin 4 globális szerkezete hasonló a humán tripszin 1-éhez, amely a 193-as pozícióban glicint tartalmaz. A két szerkezetben a C α atomok pozíciójának eltérése nem nagyobb, mint 0,5 Å. Ez a tanulmány szolgáltatta az első meggyőző bizonyítékot arra, hogy döntő mértékben az Arg193 felelős a humán tripszin 4 különös inhibitor rezisztenciájáért. A Gly193 erősen konzervált a kimotripszin-szerű proteázok körében, beleértve a legtöbb ismert gerinces tripszinogént. A humán tripszin 4-ben az Arg193 az S2 helyet foglalja el, és kinyújtott pozícióban elhelyezkedő hosszú oldallánca sztérikusan ütközik a fehérje partnerek (inhibitorok vagy szubsztrátok) megfelelő csoportjaival. Az Arg193 nyújtott pozícióban való elhelyezkedéséhez hozzájárulhat a Tyr151 aromás gyűrűje, amely interferál az Arg193 oldalláncának szabad rotációjával. A guanidino csoport töltése szintén befolyásolhatja az inhibitor kötést az elsődleges specificitási zseb környéki pozitív töltéscsoportosuláshoz való hozzájárulásával. Bár az Arg193 C α pozíciója 0,4-0,8 Å eltolódást mutat a konvencionális tripszinek Gly193 C α pozíciójához képest, ennek ellenére az oxianion lyuk geometriája megőrzöttnek tűnik. Meg kell jegyeznünk azonban, hogy az apo-enzimben más lehet ezen régió finomszerkezete, mint az S1 zseb benzamidin általi betöltöttsége esetén A humán tripszin 4 inhibitor rezisztenciája A humán tripszin 4 egyik legérdekesebb tulajdonsága a természetesen előforduló polipeptid típusú inhibitorokkal szemben mutatott rezisztenciája. A humán tripszin 4 jól 27

28 gátolható kis molekulasúlyú tripszin inhibitorokkal, mint például a benzamidin, p-amino benzamidin, N α -p-tozil-l-lizin klórmetil keton, leupeptin, illetve általános szerin proteáz inhibitorokkal, mint a diizopropil fluorofoszfát és a fenilmetilszulfonil fluorid (Katona és mtsi. 2002a; Nyaruhucha és mtsi. 1997; Rinderknecht és mtsi. 1984). Ezzel szemben, az eddig vizsgált standard mechanizmusú proteáz inhibitorok nem tudnak erős komplexet képezni a humán tripszin 4-el. Ezek közé tartozik a szarvasmarha pankreatikus tripszin inhibitor (BPTI), a humán pankreatikus szekréciós tripszin inhibitor (hpsti), a szójabab tripszin inhibitor (STI), Phaseolus lunatus (limabab) tripszin inhibitor, a csirke ovomukoid, az Alzheimer prekurzor protein inhibitor doménje (APPI) és az ekotin (Katona és mtsi. 2002a; Medveczky és mtsi. 2003; Nyaruhucha és mtsi. 1997; Rinderknecht és mtsi. 1984; Szmola és mtsi. 2003). Az inhibitor rezisztencia kifejezés megtévesztő, hiszen ezek a természetes inhibitorok a G193R mutáció ellenére is nagy affinitást mutatnak az enzim felé, bár egyensúlyi disszociációs állandójuk (K d ) 2-7 nagyságrenddel nagyobb, mint a 193-as helyen glicint tartalmazó tripszinek felé mutatott K d. A szerpinek egy olyan inhibitor családot alkotnak, melyek a proteáz katalitikus ciklusába belépve, a kovalensen kötött acil-enzim intermediert kinetikailag stabilizálva gátolják a szerin proteázokat (Gettins 2002). A szerpin inhibíciós mechanizmus első lépése hasonlóan a kanonikus inhibitorokéhoz a nem-kovalens Michaelis komplex kialakulása. Ezt követően a proteáz hasonlóan a szubsztrátok hidrolíziséhez elhasítja a szerpin reaktív helyének peptidkötését szignifikáns konformációs átalakulást indukálva, amely az acilált proteáz torzulásához és inaktiválódásához vezet. A kovalens enzim-inhibitor komplex lassan disszociálhat szabad enzimre és inaktív szerpinre. A leírt inhibíciós útvonal alternatívája lehet az acil-enzim komplex gyors dezacileződése, mielőtt a konformációváltozás és a proteáz becsapdázása megtörténne. Ezen a proteolítikus útvonalon az enzim a szerpint szubsztrátként hasítja és ezáltal inaktiválja. Fiziológiásan releváns enzim-szerpin párok esetén a proteolítikus útvonal elhanyagolható. A humán tripszin 4 rezisztens a vad típusú alfa-1-antitripszinnel (α1at) szemben is (Rinderknecht és mtsi. 1984; Szepessy és Sahin-Tóth 2006; Tóth Júlia nem közölt eredmény). Az R193G mutáns humán tripszin 4-et az inhibitor azonban a humán tripszin 1-hez és humán tripszin 2-höz hasonlóan jól gátolja, mutatva, hogy a rezisztencia kritikus meghatározója az Arg193 (Szepessy és Sahin-Tóth 2006). A humán tripszin 4 azonban szelektíven hasítja a Pittsburgh mutáns (Met358Arg) (Lewis és mtsi. 1978; Owen és mtsi. 1983) α1at reaktív helyének Arg358-Ser359 28

29 peptidkötését, és a folyamat az enzim inaktiválódásához vezet (Szepessy és Sahin-Tóth 2006; Tóth Júlia nem közölt eredmény). A humán tripszin 4 csaknem ugyanolyan gyorsan asszociál a Pittsburgh mutáns α1at-hez, mint a humán tripszin 1 és a humán tripszin 2, és a disszociációs konstans alapján a humán tripszin 4-α1AT Pittsburgh komplex 40-szer stabilabb, mint az inhibitor humán tripszin 1-el illetve humán tripszin 2-vel alkotott komplexe. Ezek az eredmények arra utalnak, hogy a szerpin mechanizmus egy lehetséges stratégia a humán tripszin 4 inhibitor rezisztenciájának legyőzésére, amennyiben a szerpin reaktív helye tartalmazza a humán tripszin 4 által preferált Arg/Lys-Thr/Ser peptidmotívumot (Szepessy és Sahin-Tóth 2006). Ezen információk alapján a glia eredetű nexin (GDN) (Scott és mtsi. 1985), melynek reaktív helyén egy Arg-Ser peptidkötés található, potenciálisan funkcionális inhibitora lehet a humán tripszin 4-nek A humán tripszin 4 szubsztrátspecificitása A humán tripszin 4 valódi tripszin-szerű specificitást mutat, és arginin, illetve lizin utáni peptidkötéseket hidrolizál. A kisméretű szintetikus kromogén, illetve fluorogén szubsztrátokat nagy katalitikus hatékonysággal hasítja. A P helyekkel kontaktusba nem lépő peptidszubsztrátokat más tripszinekkel összehasonlítható hatékonysággal hidrolizálja (Katona és mtsi. 2002a; Rinderknecht és mtsi. 1984; Szmola és mtsi. 2003): például Z-GPR-pNA szubsztráton a k cat értéke körülbelül háromszorosára, a K m értéke pedig 2-3-szorosára nő, ezért a k cat /K m értéke nem változik szignifikánsan a Gly193 argininre való cseréjének hatására (Medveczky és mtsi. 2003). P2 oldallánccal nem rendelkező amid szubsztrátokon a vad típusú humán tripszin 4 acilezési lépésének sebessége kisebb, dezacilezési lépésének sebessége pedig nagyobb, mint a humán tripszin 1-é. Munkacsoportunk vizsgálta a Z-Gly-Pro-Arg-Met-Gly-Phe- NH 2 peptid humán tripszin 4 illetve humán tripszin 1 általi hidrolízisét a termék keletkezését HPLC-vel követve, illetve a peptidet csendes szubsztrátként alkalmazva egy kompetitív rendszerben, ahol a jelet a Z-Gly-Pro-Arg-pNA kromogén szubsztrát adja. A kapott időgörbéket globális illesztéssel elemeztük. Eredményeink azt mutatják, hogy a Gly193 argininre való cseréje enyhén megnöveli a k cat értékét, míg a K m egy nagyságrenddel csökken, amit valószínűleg a szubsztrátkötéskor fellépő sztérikus interferencia okoz (Gombos Linda, nem közölt eredmény, személyes közlés). 29

30 Szemben a peptidszubsztrátokon mérhető magas aktivitásával, a humán tripszin 4 a fehérjeszubsztrátokat általában kis hatékonysággal hasítja, de az enzimatikus aktivitás sérültségének mértéke erősen függ a hasítandó célfehérje tulajdonságaitól. Így például a humán tripszin 4 a kimotripszinogént, a tripszinogént és a proelasztázt szer lassabban aktiválja, mint a humán tripszin 1 vagy a humán tripszin 2 (Szilágyi és mtsi. 2001; Szmola és mtsi. 2003). A humán tripszinogén 4 nem mutat autoaktivációt sem. A humán tripszin 1 Arg117-Val118 peptidkötésének humán tripszin 4 általi hasítása szintén 500-szor lassabb, mint a humán tripszin 1 általi hidrolízis (Szmola és mtsi. 2003). A miozin S1 kimotriptikus fragmensének humán tripszin 1, illetve humán tripszin 4 általi emésztését SDS gélelektroforézist követő denzitometrálással elemezve a humán tripszin 4 körülbelül 200-szor kisebb hatékonysággal hasítja a fehérjét, mint a humán tripszin 1 (Gombos Linda, nem közölt eredmény, személyes közlés). Másfelől viszont a humán tripszin 4 a humán tripszinogén 2-t mindössze 20-szor lassabban degradálja, mint a humán tripszin 1 (Szmola és mtsi. 2003). A kazeinből a humán tripszin 4 mindössze háromszor kisebb sebességgel szabadít fel triklór-ecetsav-szolubilis peptideket, mint a humán tripszin 1 illetve 2 (Szepessy és Sahin-Tóth 2006). Megfigyelték, hogy a humán tripszin 4 ugyan rezisztens a vad típusú α1at-vel szemben, ám szelektíven hasítja a Lys10-Thr11 peptidkötést az inhibitor N-terminálisán (Szepessy és Sahin-Tóth 2006). α1at mutáns könyvtár segítségével kimutatták, hogy a humán tripszin 4 relatíve nagy specificitással (k cat /K m ~ 10 5 M -1 s -1 ) hasít olyan lizil peptidkötéseket, melyekben a P1 pozícióban treonin vagy szerin található. Ezt a P1 preferenciát megerősíti a Pittsburgh mutáns α1at reaktív helyének (Arg358-Ser359) hasítása, egyes PAR receptor izoformák hasítása Arg-Ser illetve Lys-Thr aktiváló hasító helyeken és a mielin bázikus fehérje Arg79-Thr80 és Arg97-Thr98 peptidkötésének szelektív hidrolízise is (ld fejezet). A humán tripszin 4 tehát nem egy defektív proteáz általában véve a polipeptid szubsztrátokon, hanem relatíve nagy specificitással rendelkezik Lys/Arg-Ser/Thr peptidkötések felé. A fokozott szubsztrátspecificitás megmagyarázza azt is, hogy a humán tripszin 4 nem aktiválja a pankreatikus zimogéneket, melyek aktivációs helyén izoleucin vagy valin található a P1 pozícióban. A humán tripszin 1-ben az S1 helyre való kötődést nem akadályozza semmilyen szerkezeti elem, ennek megfelelően az S1 hely sokféle méretű és polaritású aminosav oldalláncot befogadhat (Gaboriaud és mtsi. 1996). A humán tripszin 1 és a humán tripszin 4 térszerkezetének egymásra illesztése felfedi, hogy az S1 hely szerkezeti 30

31 determinánsai azonos konformációjúak a két szerkezetben, és az S1 hely nem tűnik elzártnak semmiféle szempontból a humán tripszin 4-ben (Szepessy és Sahin-Tóth 2006). Az Arg193 oldallánca egyértelműen az S2 helyet foglalja el. A rendelkezésre álló szerkezet adatok tehát nem adnak magyarázatot a humán tripszin 4 erősen megnövekedett S1 specificitására. Sahin-Tóth és munkatársainak feltételezése szerint a szubsztrátkötési lépés konformációváltozással jár, ami mérsékli az ütközés mértékét az Arg193-al az S2 helyen és az S1 helyhez való hozzáférés részleges akadályozásához vezet (Szepessy és Sahin-Tóth 2006). A szubsztrátspecificitás azonban nem csak a szubsztrátkötés, hanem az acilezés szelektivitásából is eredhet (Ryan és mtsi. 1976). Jónéhány példa bizonyítja, hogy a k cat /K m értékének, azaz a specificitás növekedése szerin proteázoknál a k cat növekedéséből és nem a K m csökkenéséből ered (Hedström 2002). Az acilezés sebességi állandója jó és rossz szubsztrátok közt több mint ezerszeres különbséget mutat, míg a szubsztrát affinitásából eredő diszkrimináció mindössze szoros (Hedström és mtsi. 1992; Stein és mtsi. 1987; Thompson és Blout 1970) Az Arg193 szerepe Először a más tripszinekkel való szekvencia-összehasonlítás alapján merült fel az az elgondolás, hogy az Arg193 a fő meghatározója a humán tripszin 4 fehérje típusú inhibitorokkal szembeni rezisztenciájának (Nyaruhucha és mtsi. 1997). Később ezt az elképzelést megerősítette a humán tripszin 4 kristályszerkezetének elemzése (Katona és mtsi. 2002a). Végül, az Arg193 szerepét bizonyító direkt kísérleti adatokat az Arg193 irányított mutagenezissel glicinre való cseréje szolgáltatta (Medveczky és mtsi. 2003; Szmola és mtsi. 2003). Az R193G mutáns 3 humán tripszin 4 érzékennyé vált az STI-vel és a hpsti-vel szemben. Továbbá az R193G mutáns enzim majdnem ugyanolyan hatékonysággal aktiválta a kimotripszinogént mint a humán tripszin 1 és a humán tripszin 2, utalva arra, hogy az enzim teljes mértékben visszanyerte emésztő funkcióját. Az R193G mutáns humán tripszin 4 tehát gyakorlatilag azonos katalitikus tulajdonságokat és kanonikus inhibitorokkal szembeni érzékenységet mutat, mint a 3 Az R193G mutáns elnevezése megtévesztő lehet, mert a szerin proteázokban a 193-as pozícióban alapesetben glicin található. Ennek ellenére, az arginint hordozó humán tripszin 4 egy természetesen előforduló izoforma, ezért vad típusnak nevezzük. Az R193G variánst nevezhetjük back-mutánsnak illetve revertánsnak, utalva az ebben a pozícióban egyébként konzervált glicinre. 31

32 humán tripszin 1 (Szmola és mtsi. 2003). Kutatócsoportunk közelmúltbeli eredményei megerősítik ezt a megállapítást. A kanonikus inhibitorok felé mutatott egyensúlyi disszociációs konstans a vad típusú humán tripszin 4-ben 2-3 nagyságrenddel nőtt a humán tripszin 1-hez képest. Ezeket a megváltozott kinetikai paramétereket az Arg193 glicinre való visszacserélése helyreállította. Mindezen adatok alapján az R193G mutáns humán tripszin 4 a pankreatikus tripszin izoforma modelljének tekinthető. Levonhatjuk tehát a következtetést, miszerint kizárólag az Arg193 evolúciós szelekciója felelős a humán tripszin 4 inhibitor rezisztenciájáért és fokozott szubsztrátspecificitásáért. A 193-as pozícióban a nem-glicin aminosav egy másik hatása lehet, hogy a as peptidkötés geometriája torzult, ezért az S1 kötőhely és az oxianion lyuk perturbált az aktív enzimben, mint ahogy azt a XI-es faktor Gly555Glu (Gly193Glu a kimotripszin számozás szerint) mutánsa esetében leírták (Schmidt és mtsi. 2004). Ugyan a humán tripszin 4 benzamidinnel alkotott komplexének kristályszerkezete alapján az oxianion lyuk nem tűnik torzultnak, nem tudjuk, milyen az apo-enzim szerkezete ebben a tekintetben. A humán tripszin 4 kromogén szubsztrátokon mutatott, a humán tripszin 1-hez képest nem csökkent k cat /K m értéke mögött állhat az S1 kötőzseb és az oxianion lyuk optimális térszerkezete, de állhat az is, hogy ezek a szerkezeti elemek, bár az apo-enzimben torzultak, a szubsztrát S1 helyre való bekötődése visszaállítja korrekt geometriájukat. Nemrég jelent meg egy másik közlemény, amely trombinban, illetve patkány tripszinben a 193-as pozíciójú glicint érintő mutációk szerkezeti és energetikai következményeivel foglalkozik (Bobofchak és mtsi. 2005). Ebben a tanulmányban kinetikai és szerkezeti adatokból arra következtettek, hogy a Gly193 az alapállapotot (ground state) és az átmeneti állapotot (transition state) is stabilizálja, ezáltal járulva hozzá a szubsztrátkötéshez, annak ellenére, hogy nem találtak drasztikus szerkezeti peturbációt még a G193P mutáns esetén sem. Doktori munkám során azzal a kérdéssel is foglalkoztam, hogy a Gly193Arg pontmutációnak milyen hatása van a szubsztráthidrolízis egyes lépéseinek sebességére és termodinamikájára (ld. 5.4 fejezet). Vizsgáltam továbbá, hogy a Gly193-at nagyobb térkitöltésű oldallánccal rendelkező aminosavra cserélve hogyan módosul az aktiváció során bekövetkező szerkezeti átrendeződés kinetikája illetve termodinamikája (ld. 5.5 fejezet). 32

33 Tripszin inhibitorok hasítása A proteázok standard mechanizmusú inhibitorokkal alkotott komplexében az inhibitor reaktív helyének peptidkötése lassú hidrolízisen megy keresztül, kétláncú hasított és egyláncú intakt inhibitor egyensúlyi keverékéhez vezetve (Laskowski és Qasim 2000). Konvencionális tripszinek esetén ez a folyamat rendkívül lassú, és csak hónapok alatt áll be az egyensúly. Ezzel szemben, a humán tripszin 4 a standard mechanizmusú inhibitorokat szubsztrátként ismeri fel, és gyorsan hidrolizálja az STI és az APPI inhibitor domén reaktív helyének peptidkötését (Szepessy és Sahin-Tóth 2006; Szmola és mtsi. 2003; Tóth Júlia nem közölt eredmény). Az SDS poliakrilamid gélelektroforézis és az N-terminális szekvenálás megerősítette, hogy mindkét esetben a humán tripszin 4 a reaktív hely peptidkötését hasítja. Az egyensúly beálltakor az STI esetén az inhibitor molekuláknak kb. 40%-a intakt és 60%-a hasított, az APPI esetében ez az arány 20%-80%. A kanonikus inhibitorok reaktív helyén lévő peptidkötés gyors, szubsztrát-szerű elhasítása vezetett ahhoz az elgondoláshoz, hogy a humán tripszin 4-et gátolhatják egyes szerpinek, hiszen a reaktív hely peptidkötésének hidrolízise kruciális pontja a szerpin inhibíciós mechanizmusnak. A hpsti szintén a standard mechanizmusú inhibitorok közé tartozik, ám ellentétben az STI-vel, ami stabil komplexet képez a tripszinnel, a szekretált inhibitorok úgynevezett ideiglenes (temporary) inhibitorok, mert idővel irreverzibilisen disszociálnak az enzim felszínéről (Laskowski és Wu 1953). Az ideiglenes inhibitorok mechanizmusa egymást követő triptikus hasítások sorozatából áll (Schneider és mtsi. 1973; Schneider és Laskowski; 1974). A humán tripszin 4 az ideiglenes inhibíció mechanizmusa szerint hasítja a hpsti-t, ám szignifikánsan nagyobb sebességgel (Szepessy és Sahin-Tóth 2006; Szmola és mtsi. 2003), mint a 193-as pozícióban glicinnel rendelkező tripszinek. További különbség, hogy míg a konvencionális tripszinekkel való hasításnál a sebesség-meghatározó lépés a reaktív hely peptidkötésének hidrolízise, addig a humán tripszin 4 esetén a reaktív hely elhasítását követő inaktiváló hasítások sokkal lassabbak a reaktív hely hidrolízisénél, és ezek határozzák meg az inhibitor degradáció sebességét. 33

34 A humán tripszinogén 4 aktivációja A humán tripszinogén 4 fiziológiás aktivátora az enterokináz, amely a vékonybélben az enterociták kefeszegély membránjában lokalizált, és minden szekretált pankreatikus tripszinogént képes aktiválni. Az enterokináz transzkripcióját kimutatták a humán tripszinogén 4-et is termelő különböző epitheliális sejtvonalakban is. Szemben a humán tripszinogén 1-el és humán tripszinogén 2-vel, a humán tripszinogén 4 nem képes autoaktivációra (Medveczky és mtsi. 2003; Szmola és mtsi. 2003). A humán tripszin 1 és humán tripszin 2 általi aktiváció szintén lassú és kis hatékonyságú, és a humán tripszinogén 4 jelentős mértékű degradációjához vezet (Szmola és mtsi. 2003). A humán tripszinogén 4-et a lizoszómális cisztein proteáz, a katepszin B is aktiválja, amely kísérletes pankreatitiszben a tripszinogén aktiválásáért felelős (Halangk és mtsi. 2000; Kukor és mtsi. 2002). Humán agyszövetből immunaffinitás kromatográfiával izolálható a humán tripszinogén 4 és a felaktivált enzim is (Tóth és mtsi. 2006b) ami arra utal, hogy az aktiváció a központi idegrendszer szöveteiben is megtörténhet A humán tripszin 4 lehetséges funkciói A humán tripszin 4 potenciális fiziológiás és patológiás szerepe a hasnyálmirigyben A pankreaszban expresszálódó humán tripszin 4 valószínűleg nem játszik jelentős szerepet a táplálék fehérjéinek degradálásában, egyrészt, mert emésztési funkciója sérült, másrészt, mert a humán tripszin 1 és a humán tripszin 2 sokkal nagyobb tömegben fordul elő a pankreatikus folyadékban, és katalitikus hatékonyságuk is nagyobb polipeptid típusú szubsztrátok esetén. Sokáig az enzim egyetlen funkciójának a táplálék fehérje típusú tripszin inhibitorainak degradálása tűnt (Szmola és mtsi. 2003). A humán tripszin 4 általi inhibitor degradáció azonban csak magas inhibitor koncentrációk esetén válhat szignifikánssá, hiszen alacsony koncentrációk esetén az inhibitorok komplexálva lesznek a humán tripszin 1 és a humán tripszin 2 által. Hasonló érvelés alapján az ideiglenes inhibitorok degradálását is valószínűleg inkább a humán tripszin 1 és a humán tripszin 2 végzi. 34

35 A pankreatikus humán tripszin 4 patológiás szerepe kapcsán két, egymással ellentmondó elmélet is született, melyek szerint a humán tripszin 4 a pankreaszban való idő előtti felaktiválódása pankreatitiszt okozhat, illetve megakadályozhatja a pankreatitisz kialakulását, mivel az inhibitor rezisztens tripszin szabadon aktiválhat, illetve degradálhat egyéb pankreatikus zimogéneket (Nyaruhucha és mtsi. 1997; Rinderknecht és mtsi. 1984). Kísérletes adatok egyértelműen mutatják, hogy a humán tripszin 4 nem képes a pankreatikus zimogének aktiválására, és a humán tripszinogének degradációjára való képessége is sérült (Rinderknecht és mtsi. 1984; Szilágyi és mtsi. 2001; Szmola és mtsi. 2003). Ezen adatok szerint nem valószínű, hogy a humán tripszin 4 szerepet játszana pankreatikus zimogének aktiválásában vagy degradálásában. Másfelől az a megfigyelés, miszerint a humán tripszin 4 elhasítja a standard mechanizmusú inhibitorokat, felveti a lehetőséget, hogy az enzim pankreaszban való felaktiválódása hozzájárulhat a pankreatitisz pathogeneziséhez a hpsti védő szintjének lecsökkentése révén. A betegség ily módon való kialakulásához szükséges egy relatíve specifikus humán tripszinogén 4 aktivátor jelenléte a pankreasz acinus sejtjeiben. In vitro a katepszin B gyorsan és a humán tripszinogén 1-gyel és humán tripszinogén 2-vel szemben preferált módon aktiválja a humán tripszinogén 4-et (Szmola és mtsi. 2003). A humán tripszin 4 által indukált pankreatitisz modell biokémiai háttere tehát elvben létezik, a mechanizmus gyakorlati jelentőségét azonban még nem igazolták A humán tripszin 4 potenciális fiziológiás és patológiás szerepe extrapankreatikus szövetekben Az extrapankreatikus humán tripszin 4 agonistája lehet egyes proteáz-aktivált receptoroknak. A PAR család egy olyan G-protein kapcsolt receptor család, melyek szerin proteázok általi hasítást követően aktiválnak jelátviteli útvonalakat (Macfarlane és mtsi. 2001; Ossovskaya és Bunnett 2004). A receptorhoz kipányvázott ligand domének a hasítás révén válnak kitetté és a hasított receptorhoz kötődnek, ami ezáltal aktiválódik. A PAR-ok szerepet játszanak a hemosztázis szabályozásában, gyulladási és gyógyulási folyamatokban. Epitheliális sejtekben a humán tripszin 4 szubsztrátjaként azonosították a PAR-2-őt és a PAR-4-et (Cottrell és mtsi. 2004). Később ezeket az eredményeket kétségbe vonták, és kimutatták, hogy a PAR-1-et képes aktiválni a humán tripszin 4 az agyban (Grishina és mtsi. 2005; Wang és mtsi. 2006). A hasítási helyen túl a proteáz és a receptor közötti egyéb kölcsönhatások is befolyásolják, hogy a humán 35

36 tripszin 4 aktivál-e egy adott PAR izoformát. Továbbá a PAR-ok faj- és szövetspecifikus glikozilációja szintén megváltoztathatja az aktiválási tulajdonságokat, ami magyarázhatja a közölt ellentmondó adatokat. Tisztázatlan továbbá, hogy a humán tripszin 4 szekretált izoformája expresszálódik-e extrapankreatikus szövetekben, illetve a valószínűleg intracelluláris humán tripszinogén 4 A és B izoformájának tulajdonságai még ennél is homályosabbak. A humán tripszin 4-ről nemrég munkacsoportunk leírta, hogy az enzim in vitro szelektíven processzálja az Arg79-Thr80 és Arg97-Thr98 peptidkötéseknél a mielin bázikus fehérjét, amely a legnagyobb mennyiségben előforduló membránfehérje a központi idegrendszerben (Medveczky és mtsi. 2006). Az enzim proteolítikus hasítása során egy olyan peptidfragmens keletkezik, mely magába foglalja azt a szekvenciát, melyet a sclerosis multiplexben szenvedő betegekből izolálható fő ellenanyagok felismernek. Ezek az eredmények arra utalnak, hogy a humán tripszin 4 egyike lehet ezen neurodegeneratív betegség pathomechanizmusában potenciálisan részt vevő proteázoknak. A humán tripszinogén 4 transzgenikus expressziója egér agyi neuronokban a GFAP megnövekedett termelését okozta az asztrocitákban, utalva ezen sejtek megnövekedett aktivációjára, amely jelenség általában megfigyelhető Alzheimer kórban és egyéb típusú agyi sérüléseknél (Minn és mtsi. 1998). A transzgén egerekben azonban neurodegenerációra utaló jeleket nem találtak. Megfigyelték viszont a β-amiloid intracelluláris szintjének megnövekedését, bár extracelluláris lerakódásokat vagy plakkokat nem tudtak kimutatni. Ezen megfigyelés jelentősége még nem tisztázott. Tumor eredetű epitheliális sejtvonalak mellett (Cottrell és mtsi. 2004) a humán tripszinogén 4 mrns-ét kimutatták nyelőcső squamosa sejtes karcinómákban és gyomor adenómákban is, és korrelációt találtak a PRSS3 gén promóter hipermetiláció általi downregulációja és a magasabb fokú tumor invázió között (Yamashita és mtsi. 2003). Ezekből az eredményekből arra következtettek, hogy a tripszinnek ezekben a sejtvonalakban tumor-szuppresszív szerepe van. Ezzel szemben, nem-kissejtes tüdőrák esetében kimutatták, hogy a kalcium-függő válaszban sokféle szerepet betöltő kalciumkötő S100-as fehérjék és a humán tripszinogén 4 expressziója asszociált a metasztázissal: e fehérjék túltermelése fokozta a tumoros sejtek transzepitheliális migrációját (Diederichs és mtsi. 2004). 36

37 2. CÉLKITŰZÉSEK Doktori munkám során számos izgalmas, a humán tripszin 4-el kapcsolatos kérdésre kerestem választ, melyek a gén alternatív izoformáinak transzkripciójával, a különböző izoformák membránkötő képességével, illetve az enzim aktivációja és működése során bekövetkező szerkezeti átrendeződések gyorskinetikai és termodinamikai tulajdonságaival kapcsolatosak. Munkám öt fő kérdés köré csoportosítható. (I) A humán tripszinogén 4 gén transzkripciójának vizsgálatával célom az volt, hogy meghatározzam, mely izoformák kerülnek transzkripcióra humán agyszövetben, illetve célom volt az mrns 5 végi szekvenciájának elemzése is 5 RACE PCR technikával. (II) Célul tűztem ki a humán tripszinogén 4 A és B izoformájának klónozását és heterológ rendszerben történő expresszióját. Ezen izoformák különlegességét nem-konvencionális, a szekréciós szignálszekvenciáktól eltérő karakterű N-terminális peptidjük adja. Mivel a fehérjék N-terminális szekvenciái sok esetben membránhorgonyzó funkciót töltenek be, megvizsgáltam, mutat-e a humán tripszinogén 4 A és B izoformája affinitást biológiai membránok felé. (III) Célom volt a humán tripszinogén 4 mrns-ének mennyiségi meghatározására alkalmas real-time PCR módszer beállítása, a reakciókörülmények optimalizálása, hogy meghatározhassam a transzkriptum relatív mennyiségét különböző humán agyi területekről származó szövetmintákban. Az mrns regionális eloszlása a humán agyban információval szolgálhat a fehérje központi idegrendszerben betöltött további szerepéről. (IV) Bár a humán tripszin 4 széleskörűen karakterizált és számos szempontból vizsgált enzim, a konzervált Gly193 argininre való cseréjének termodinamikai következményei a szubsztráthidrolízis során jelenleg nem ismertek. Doktori munkám ezen részének célja az volt, hogy azonosítsam azokat az enzimatikus lépéseket, amelyeket befolyásol a Gly193Arg mutáció a humán tripszin 4-ben. Továbbá fényt próbáltunk deríteni a vad típusú és az R193G mutáns humán tripszin 4 szubsztráthidrolízisének termodinamikája közti különbségekre. Ebből a célból expresszáltam a vad típusú, illetve az R193G mutáns humán tripszin 4-et és tanulmányoztam a reakciójukat 4-metilumbelliferil 4-guanidinobenzoát (MUGB) 37

38 fluorogén szubsztrát analógon stopped flow készüléket használva. Ez a szubsztrát azért alkalmas a munkához, mert ismert, hogy a dezacilezés a MUGB esetén lassabb, mint az acilezés, és az egyes reakciólépések sebességi állandóinak egyértelmű meghatározásához előfeltétel, hogy az utolsó reakciólépés legyen a sebesség-meghatározó. (V) Doktori munkámnak további célja volt, hogy tanulmányozzam a 193-as pozícióban elhelyezkedő csukló régiót érintő pontmutációk hatását az aktiváció során bekövetkező konformációváltozás sebességére, és karakterizáljam ennek a szerkezeti átrendeződésnek a termodinamikáját. A szerin proteázok aktivációs doménjének átrendeződése az aktiváció során egy ph-ugrással kiváltható, egylépéses elsőrendű átmenet, melyet a fehérjében belső jelváltozás kísér, ami egy elegáns kísérleti megközelítést nyújt a konformációs átmenet vizsgálatához. Expresszáltam a vad típusú és az R193G/A/Y/F mutáns humán tripszin 4-et és követtem az aktiváció során történő konformációváltozásukat a hőmérséklet és az oldat viszkozitásának függvényében ph-ugrásos stopped flow kísérletekben a belső fluoreszcenciaváltozást detektálva. 3. AZ ALKALMAZOTT MÓDSZEREK ELMÉLETI HÁTTERE RACE PCR A RACE (Rapid Amplification of cdna Ends) PCR technika alkalmas mrns templátról egy meghatározott belső hely és az mrns 5 illetve 3 végi ismeretlen szekvenciája közti nukleinsav szekvenciák amplifikálására (Frohman és mtsi. 1988). Ezt a technikát, melyben csak az egyik oligonukleotid gén-specifikus, egy-oldalú, illetve horgonyzott PCR-nek is nevezik. Általában egy komplex keverékben lévő kisszámú célmolekula PCR amplifikálásához két szekvencia-specifikus primer szükséges, amelyek a sokszorozandó szekvenciát határolják. Ismeretlen szekvenciák amplifikálása esetén a megoldást az 5 illetve 3 RACE technikák jelentik. Az 5 RACE egy olyan technika, amely lehetővé teszi 5 végek izolálását és karakterizálását alacsony kópiaszámú mrns-ekről (6. ábra). 38

39 6. ábra Az 5 RACE folyamatának áttekintése A technikáról több összefoglaló cikket is publikáltak (Frohman 1990; Frohman 1993). Ennél a technikánál a cdns első szálának szintézise egy génspecifikus antiszensz primerrel (GSP1) történik. Ezáltal a specifikus mrns vagy rokon mrns-ek cdns-sé írhatók át. A cdns szintézist követően az egyszálú termék mellől el kell távolítani a szintéziskor be nem épített dntp-ket és GSP1 oligonukleotidokat. Ezután terminális dezoxinukleotidil transzferáz enzimmel a cdns 3 végére homopolimer farkat szintetizálunk. A farkazott cdns ezután PCR reakcióval sokszorozható egy fészkelt (nested) génspecifkus primerrel (GSP2), mely egy, a GSP1-től 3 irányban lévő hellyel komplementer, illetve a homopolimer farokra komplementer szekvenciát tartalmazó horgony oligonukleotiddal. Ezáltal lehetővé válik a GSP2 és az mrns 5 vége közé eső ismeretlen szekvenciák amplifikálása. A kapott 5 RACE PCR termék megfelelő vektorba ligálható karakterizálás céljából, amely lehet szekvenálás, restrikciós térképezés, próbák szintézise vagy in vitro RNS szintézis. A RACE termékek 39

40 karakterizálása sokszor megkívánja a specificitás megerősítését. Ez elvégezhető további PCR reakciók futtatásával, a horgonyzó primerre anelláló oligonukleotidok (ld. az ábrán AUAP, Abridged Universal Amplification Primer, az 5 RACE PCR során a reamplifikáláshoz használható rövidített horgonyzó primer; UAP, Universal Amplification Primer, az 5 RACE PCR során a reamplifikáláshoz használható általános horgonyzó primer) és egyéb fészkelt génspecifikus oligonukleotidok segítségével. A fészkelt PCR reakciókat alkalmazni lehet a klónozáskor a PCR termék feldúsítása érdekében is. Az optimális eredmény eléréséhez legfontosabb lépések az RNS izolálása, a primerek tervezése és az amplifikáció körülményeinek meghatározása. A homopolimer primerek olvadási hőmérséklete magasabb (poli(dg) vagy poli(dc) esetén) vagy alacsonyabb (poli(da), illetve poli(dt) esetén), mint egy tipikus génspecifikus primeré. Specificitásuk is alacsony, ami belső szekvenciákhoz való párosodást okozhat. Ezen problémák megoldására az alkalmazott 5 RACE rendszerben az AAP (Abridged Anchor Primer, az 5 RACE PCR-hez használt rövidített horgonyzó primer) primer a poli(dg) szakaszában dezoxiinozin nukleotidokat tartalmaz (ld. Függelék). A dezoxiinozin bázispárosodásra képes mind a négy bázissal, bár eltérő affinitással. A dezoxiinozin bázisok 3 végen való szelektív elhelyezésének következtében az AAP olvadási hőmérséklete (66,6 C) hasonló lesz egy tipikus húsztagú, 50% GC tartalmú primer olvadáspontjához (Rychlik és Rhoads 1989). Ez maximalizálja az anellálást az oligo-dc farokhoz, minimalizálja a félre-anellálást belső C-gazdag régiókhoz a cdns-ben, és kiegyenlített olvadási hőmérsékletet biztosít a horgony régió és a génspecifikus primer között, ami szükséges a hatékony PCR reakcióhoz. 3.2 A tradicionális és a real-time kvantitatív PCR összehasonlítása Hagyományos PCR reakciók esetében a keletkezett terméket a reakció lezajlása után detektáljuk. A reakcióelegy agaróz gélen történő megfuttatását és a gél (általában etídium bromiddal történő) megfestését követően tehát végpontdetektálás történik. Az eredmény értékelése méret apján történő elválasztáson alapszik, aminek kicsi a pontossága. A módszer felbontóképessége alacsony, a kimutatás érzékenysége szintén alacsony, dinamikus tartománya (az a tartomány, amin belül a termék mennyisége és a detektált jel intenzitása egyenes arányosságban áll egymással) igen szűk (<2 log). 40

41 Mindezeken felül a módszer nem automatizálható, és az etídium bromiddal történő festés nem kvantitatív. A végpontdetektálással nyert adatokból mennyiségi információ csak korlátozottan nyerhető, aminek megértéséhez szükséges a PCR egyes fázisainak főbb jellemzőit áttekintenünk. Egy átlagos PCR reakció három fázisra bontható: az exponenciális, a lineáris és a plató fázisra. Az exponenciális fázis során minden ciklusban a termék mennyisége megkétszereződik, az amplifikálás hatásfoka 100%. A reakció nagyon specifikus és pontos. A lineáris fázisban (avagy a nagy variabilitású fázisban) a reakció komponensei fogynak, a reakció lassul és a termékek degradálódni kezdenek. A komponensek fogyása reakcióelegyenként más és más lesz, így az azonos kiindulási templátmennyiségű párhuzamos mintákban a keletkező termék mennyisége kezd eltérni egymástól. A plató fázisban (végpont, amelyben a tradicionális PCR során a detektálás történik) a reakció leáll, nem keletkeznek újabb termékek, és ha kellő ideig hagyjuk a reakcióelegyet állni, a termékek degradálódnak is. Mindezek eredményeképpen a végpontban a párhuzamos minták jelentősen eltérnek egymástól. Kvantitatív információ tehát csak akkor nyerhető, ha a reakció exponenciális fázisában detektálunk, ahol a párhuzamos mintákban a termékek mennyisége közel azonos. Real-time PCR esetében a termék keletkezését folyamatosan detektáljuk a reakció során. Az adatokat ezután az exponenciális fázis elemzésével kapjuk. A detektálási stratégia többféle is lehet. Munkám során a SYBR Green I festéket használtam a detektáláshoz, mely a kettős szálú DNS kisárkához köt, és ekkor megnő fluoreszcencia emissziójának intenzitása. A mért jel intenzitása az exponenciális fázisban egyenesen arányos a keletkezett PCR termék mennyiségével, és a dinamikus tartomány jóval szélesebb, mint az etídium bromiddal való kimutatás esetén. Ezen detektálási mód hátránya, hogy szekvenciától függetlenül a festék minden kettős szálú DNS-hez köt, így a reakció specificitását a detektált fluoreszcens jel közvetlenül nem bizonyítja. Ennek ellenőrzésére a reakció lezajlása után a reakcióelegy felfűthető, miközben folyamatosan detektáljuk a fluoreszcencia intenzitását. A fluoreszcencia intenzitás hirtelen csökkenése a DNS két szálának hő hatására történő szétválását jelzi. A hőmérséklet függvényében ábrázolva a mért fluoreszcencia negatív első deriváltját megkapjuk a DNS olvadási görbéjét (-df/dt vs. T), melynek csúcsa megadja a PCR termék olvadási hőmérsékletét (Ririe és mtsi. 1997), a görbe alatti terület pedig arányos a termék mennyiségével. Specifikus reakció esetén egyetlen olvadási hőmérsékletet 41

42 kapunk. A PCR termék vektorba ligálható, és szekvenálásával a reakció specificitása egyértelműen igazolható. 3.3 Steady state és tranziens (pre-steady state) kinetika összehasonlítása Mikor egy enzimet nagy feleslegű szubsztráttal keverünk össze, a reakciónak lesz egy kezdeti szakasza, a pre-steady state, amely alatt az enzim-kötött intermedierek koncentrációja beáll a steady state értékre. Definíció szerint a steady state a reakció azon szakasza, melyben az enzim-kötött intermedierek (enzim-szubsztrát komplex) keletkezésének és elbomlásának sebessége azonos, tehát az enzim-kötött intermedierek (enzim-szubsztrát komplex) koncentrációja időben állandó. Tradicionálisan a reakciók sebességét a steady state alatt szokták mérni. A steady state kinetikai mérések általánosan alkalmazottak, de közvetett módszerek, mellyel információt kaphatunk az adott enzim katalitikus konstansáról (k cat ) és Michaelis konstansáról (K m ), melyek hányadosából számolható az enzim katalitikus hatékonysága (k cat /K m ). Ez igen fontos információ az enzim működéséről. Steady state kinetikai mérési módszerekkel is lehetséges intermedierek detektálása, vagy akár egyedi sebességi állandók mérése, de ezek nem általánosan alkalmazható módszerek, és függenek a mechanisztikus interpretációtól. Ilyen módszer például a steady state kinetikával mért enzimreakció egyes lépéseinek szelektív megváltoztatása bizonyos reagensek segítségével (Berezin és mtsi. 1971). Az egyedi reakciólépések sebességi állandójának méréséhez és tranziens intermedierek detektálásához azt a sebességet kell mérnünk, amivel a rendszer eléri a steady state-et (Fersht 1985). Az egyedi sebességi állandókat a reakció azon szakaszában lehet mérni, amelyben a steady state kialakul. A pre-steady state kinetika a reakció korai fázisa során a tranziens enzim-kötött speciesek keletkezésének és elbomlásának detektálásával és elemzésével foglalkozik. A megfigyelt folyamat általában egy enzim species egy másik állapotba való átmenetének elsőrendű sebessége. Ezek időgörbéje általában exponenciális, szemben a steady state lineáris ábrázolásaival. A pre-steady state eseményei alatt az enzim egyetlen turnoveren megy keresztül, míg a steady state alatt többszörös turnover történik. Steady state kinetikai méréssel a reakciómechanizmusra az egyes reakciókomponensek (enzim, szubsztrát, termék) 42

43 steady state-beli koncentrációjának egymáshoz képesti arányából lehet következtetni. Ezzel szemben, a tranziens kinetikában az egyes komponensek koncentrációjának időbeli változásából következtetünk a reakció mechanizmusára. Mivel az enzimreakciókban az egyedi lépések sebességi állandójának értéke általában 1 és 10 7 s -1 közötti, a pre-steady state méréseket az s időtartományban kell végezni. Gyorskeveréses technikákkal az enzim és a szubsztrát (vagy egyéb reaktáns) a milliszekundum törtrésze alatt összekeverhető egymással (az enzimek többségének turnover száma kisebb 1000 s -1 -nél). Az egyik gyorskeveréses módszer az általam is alkalmazott stopped flow (megállított áramlásos) technika. 43

44 4. ANYAGOK ÉS MÓDSZEREK RACE PCR Az 5 RACE PCR-hez a totál RNS-t mg agyszövet mintákból izoláltam TRI-reagenssel (Sigma), a gyártó leírása szerint. Az RNS csapadékot 20 µl DEPCkezelt nukleázmentes desztillált vízben (Fermentas) oldottam fel és 20 egység RNáz inhibitort (Fermentas) adtam a mintákhoz. A cdns első szálát génspecifikus primer (GSP1) segítségével szintetizáltam (Az Anyagok és módszerek című fejezetben szereplő oligonukleotidok szekvenciáját lásd a Függelék című fejezetben). 20 pikomól GSP1-et anelláltattam 6 µg totál RNS-hez 70 C-on való 5 perces inkubálást követő jégen való hűtéssel. A reverz transzkripciót RT puffer (50 mm Tris-HCl, ph 8,3, 50 mm KCl, 4 mm MgCl 2, 10 mm DTT végkoncentrációk), 20 egység RNáz inhibitor, 1 mm dntp keverék és 200 egység egér leukémia vírus reverz transzkriptáz (RevertAid H Minus First Strand cdna Synthesis Kit, Fermentas) hozzáadásával végeztem 20 µl végtérfogatban. A keveréket 37 C-on 5 percig, végül 42 C-on 60 percig inkubáltam. A reakciót 70 C-on való 10 perces inkubálással állítottam le. A szintetizált cdns-t szilika oszlopon (PCR-M Kit, Viogene) tisztítottam, hogy eltávolítsam a felesleges, be nem épült nukleotidokat, illetve GSP1-et, majd homopolimer farkat szintetizáltam hozzá, hogy kötőhelyet állítsak elő a rövidített horgonyzó primer (Abridged Anchor Primer, AAP) számára a cdns 3 végén. 0,25 mm 2 -dezoxicitidin 5 -trifoszfátot (dctp) adtam TdT pufferben 10 µl cdns-hez, 3 percet 95 C-on inkubáltam, majd lehűtöttem jégen, és 20 egység terminális dezoxinukleotidil transzferázt (TdT) (Fermentas) adtam hozzá. A reakciót 37 C-on 10 percig hagytam zajlani, majd 70 C-on történő 10 perces inkubálással állítottam le. Az így előállított C-farkazott cdns-t PCR reakcióban amplifikáltam a rövidített horgonyzó primerrel (AAP, 5 RACE System, Gibco BRL) és egy fészkelt génspecifikus primerrel (GSP2). A PCR reakcióhoz Taq polimeráz enzimet és a következő hőprofilt alkalmaztam: 3 perc 95 C, majd 35 ciklus 45 másodperc 95 C, 45 másodperc 55 C és 60 másodperc 72 C. A kapott PCR terméket standard protokollok alapján végzett agaróz gélelektroforézissel (Sambrook (szerk.) 1989) 1%-os agaróz gélen futtattam meg, gélből 44

45 izoláltam, majd pbluescript II KS-T vektorba klónoztam TA-ligálással. A klónokat a BigDye 3.0 szekvenáló kit (Applied Biosystems) segítségével szekvenáltam. A pbluescript II KS-T vektor előállításához a pbluescript II KS vektort tompa végeket generáló restrikciós endonukleázzal, az EcoRV-tel (Fermentas) nyitottam fel, majd a linearizált vektort 2,5 térfogat abszolút etanollal való kicsapással tisztítottam. A linearizált vektor 5 végeire az egybázisos túlnyúló timidint 20 egységnyi terminális dezoxinukleotidil transzferázzal (Fermentas) szintetizáltam ~1,5 µg felnyitott vektor, 200 mm kálium kakodilát, 25 mm Tris, ph 7,2, 0,01% (v/v) Triton X-100, 1 mm CoCl 2, 0,33 mm ddttp (Fermentas) összetételű reakcióban 30 C-on való 30 perces inkubálással. A reakcióelegyet 1%-os agaróz gélen futtattam, majd a nagy fragmenst gélből izoláltam, megkapva a pbluescript II KS-T vektort. 4.2 Real-time kvantitatív PCR Totál RNS izolálása agyszövetből A különböző agyterületekről punch technikával izolált agymintákat Prof. Palkovits Miklós (Semmelweis Orvostudományi Egyetem, Anatómia tanszék, Neuromorfológiai Laboratórium) bocsátotta rendelkezésemre. A mintákat az RNS preparálásig -80 C-on tároltam. A totál RNS-t mg szövetmintából izoláltam TRI reagenssel (Sigma) a gyártó utasításai szerint. Az RNS csapadékot 20 µl DEPCkezelt nukleáz-mentes desztillált vízbe (Fermentas) oldottam vissza, és 20 egység RNáz inhibitort (Fermentas) adtam a mintákhoz, hogy minimalizáljam az RNS degradációt. Az RNS mintákat azonnal felhasználtam cdns szintéziséhez cdns szintézis A cdns első szálát random hexamer primer segítségével szintetizáltam 5 µl RNS mintát használva templátként. A reverz transzkripciót 20 µl végtérfogatban végeztem. 0,2 µg random hexamer primert anelláltattam az RNS templáthoz 12 µl térfogatban 70 C-on való 5 perces inkubálással majd a minta 4 C-ra való lehűtésével. 45

46 A reverz transzkripciót RT puffer (50 mm Tris-HCl, ph 8,3, 50 mm KCl, 4 mm MgCl 2, 10 mm DTT végkoncentrációk), 20 egység RNáz inhibitor, 1 mm dntp keverék és 200 egység RevertAid TM H Minus egér leukémia vírus reverz transzkriptáz hozzáadásával végeztem (RevertAid TM H Minus First Strés cdna Synthesis Kit, Fermentas). A reakcióelegyet a random hexamer primer relatíve gyenge kötődése miatt először 10 percet inkubáltam 25 C-on, majd a primerek enzim általi meghosszabbítása után 60 percet inkubáltam 42 C-on. A reakciót 70 C-on való 10 perces inkubálással állítottam le. A szintetizált cdns mintákat -80 C-on tároltam a real-time PCR elvégzéséig, amit általában 24 órán belül elvégeztem. Egy adott kísérlethez használt RNS mintákat általában egyszerre írtam át cdns-re, hogy minimalizáljam a reverz transzkripcióval asszociált varianciát a minták között. Mivel az RT pufferben lévő DTT interferál a SYBR Green festék DNS-hez való kötődésével, illetve a fluoreszcenciával (Lekanne Deprez és mtsi. 2002), a cdns mintákat úgy mértem be a PCR reakcióba, hogy a DTT maximális koncentrációja a reakcióelegyben 100 µm legyen Külső standardok előállítása A humán agyból preparált cdns-ről amplifikáltam a humán tripszinogén 4 és a humán β-aktin kódoló szekvenciáinak szegmenseit Taq polimerázzal a htry4_f, htry4_r, hβact_f, hβact_r oligonukleotidok segítségével. A kapott PCR termékeket TA ligálással pbluescript II KS-T vektorba klónoztam. Egyszálú RNS szintézise céljából a templát htry4-fragmens-pbluescript plazmidot SacI, az aktin-fragmens-pbluescript plazmidot pedig HindIII restrikciós endonukleázzal linearizáltam. 0,5 µg felnyitott plazmidról in vitro transzkripciós reakciót végeztem 50 µl végtérfogatban transzkripciós puffer (40 mm Tris-HCl, ph 7,9, 6 mm MgCl 2, 10 mm DTT, 10 mm NaCl és 2 mm spermidin), 2 mm dntp keverék, 50 egység RNáz inhibitor és az inzert irányultságától függően 30 egység T7, illetve T3 RNS polimeráz (Fermentas) hozzáadásával. A reakcióelegyet 2 órán át inkubáltam 37 C-on, majd 1 egység RNáz-mentes DNázI-et (Fermentas) adtam hozzá, amellyel 37 C-on 30 percig inkubáltam a mintát, hogy degradálja a templát DNS-t. A standard RNS oldatokat RNS kötő oszlopra vittem fel (Total RNA Mini Kit, Viogene), hogy eltávolítsam a be nem épült nukleotidokat és a DNázI-et, majd 50 µl DEPC kezelt desztillált vízzel (Fermentas) eluáltam. 20 egység RNáz inhibitor hozzáadását követően 46

47 a mintákat -80 C-on tároltam. A tisztított RNS standardok koncentrációját az optikai denzitás 260 nm-en való mérésével az OD = 40 µg/ml összefüggés segítségével határoztam meg. A 0,225 ng aktin fragmens illetve 0,675 ng humán tripszinogén 4 fragmens RNS felhasználásával szintetizált cdns-eket használtam standard törzsoldatokként a real-time PCR kísérletekhez Primer tervezés A real-time PCR reakcióhoz használt oligonukletidokat a Primer Express v2.0 (Applied Biosystems) programmal terveztem GenBank szekvenciák alapján (humán tripszinogén 4: X71345, humán β-aktin: V01217). A primereket a program az alábbi kritériumok szerint szelektálja: az optimális primer 20 bázis hosszúságú, GC tartalma 30-80%, olvadási hőmérséklete C, nem tartalmaz azonos bázisból álló sorozatot és a 3 végi öt nukleotid között nincs kettőnél több G és vagy C. Az 5 oligonukleotidok egyaránt exon-exon határokat átfedve anellálnak a templátra, hogy a genomi DNS szennyeződésről amplifikálás ne történhessen. A valósidejű PCR reakcióhoz a htry4_rt_f, htry4_rt_r, hβact_rt_f, hβact_rt_r oligonukleotidokat használtam. Az amplikon mérete a humán tripszinogén 4 esetében 154 bázispár, a humán β-aktin esetén pedig 163 bázispár. A kiválasztott primerek negatívak voltak a másodlagos szerkezeti és a primer dimer képződési tesztben. A primerekből steril TE (10 mm Tris-HCl, ph 8,0, 1 mm EDTA) oldattal 100 µm-os koncentrációjú törzsoldatokat készítettem, a PCR reakcióhoz tovább higítottam 1,25 µm-os koncentrációjúra, és -20 C-on tároltam. A primerek specificitását a PCR termék olvadási görbéjének analízisével, illetve néhány PCR termék klónozásával és szekvenálásával igazoltam Real-time kvantitatív PCR A real-time kvantitatív PCR reakciókat ABI Prism Sequence Detection System 7000 (Applied Biosystems) készülékkel végeztem SYBR Green I kettősszálú DNShez kötő fluoreszcens festéket használva a detektáláshoz. Minden mintát három párhuzamos reakcióban futtattam, melyek 2,5 µl cdns templátot, 12,5 µl SYBR 47

48 Green reakció keveréket (SYBR Green Master Mix, Applied Biosystems), 50 nm humán tripszinogén 4, illetve humán β-aktin-specifikus oligonukleotidot tartalmaztak 25 µl reakció-térfogatban. A kétlépcsős PCR reakció hőprofilja a következő volt: 95 C 10 perc a kémiailag módosított DNS polimeráz aktiválásához, majd 40 ciklus 95 C 15 másodperc és 60 C 1 perc. Minden reakcióra meghatároztuk az amplifikálási küszöbértéket (threshold cycle, Ct érték), amely definíció szerint az a PCR ciklusszám, amelynél a Rn (normalizált riporter változás) átlépi a fluoreszcens jel küszöböt. A méréshez használt reagens tartalmaz egy passzív referenciaként használt fluoreszcens festéket is, a ROX-ot. A PCR reakció folyamán a készülék folyamatosan detektálja mindkét festék fluoreszcenciájának intenzitását. Az adatok analízise során a program a riporter festék, a SYBR Green fluoreszcencia intenzitását automatikusan normálja a passzív referencia festék fluoreszcencia intenzitásával, ezáltal korrigálhatóak az adatok a koncentráció, illetve térfogatbeli eltérésekre nézve. Ez a normalizált riporter (Rn) érték. A kiértékelés során a normalizált riporter változás ( Rn) adatokat használjuk, mely az adott PCR körülmények között generált jel nagysága, ami a templátot is tartalmazó reakció Rn értékének (Rn + ) és a templátot nem tartalmazó reakció Rn értékének (Rn - ) a különbsége ( Rn = (Rn + ) (Rn - ). Az Rn - értéket megadja a reakció korai ciklusainak (általában az ciklus) Rn értéke is, ahol detektálható fluoreszcencia intenzitás növekedés még nem történik. A mért jel tehát a normalizált fluoreszcencia változás ( Rn) a ciklusszám függvényében. A Ct értékeket a standard görbék segítségével intrapolálással RNS mennyiségre számoltam át. Az utolsó PCR ciklust követően felvettem az olvadási görbéket, hogy igazoljam, hogy az amplifikáció során keletkezett PCR termék homogén. 4.3 A humán tripszinogén 4 A és B izoformájának klónozása és expressziója A humán tripszinogén 4 szekréciós peptiddel rendelkező izoformája humán hasnyálmirigy cdns könyvtárból klónozva a rendelkezésemre állt pet-17c vektorban. A klónozás folyamata és a konstrukció részletes leírása megtalálható Katona Gergely és munkatársai munkájában (Katona és mtsi. 2002a). A termelt fehérje N-terminális 48

49 aminosavai a proteáz domén határáig a következők: MSTQAFPVDDDDK. Ez nem azonos a C izoforma természetes aktivációs peptidjével (FLILAFVGAAVAVPFDDDDK), de karakterében ez is egy szekréciós szignálszekvenciának felel meg (az AFPVDDDDK a patkány tripszinogén 2 propeptid szekvenciája). A továbbiakban ezt a fehérjét rekc izoformaként említem. A humán tripszinogén 4 B izoformáját humán agyi cdns-ből klónoztam a htry4b_f és a htry4b_r oligonukleotidok segítségével. A PCR terméket 1%-os agaróz gélen futtattam meg, majd 2,5 térfogat jéghideg abszolút etanollal való kicsapással tisztítottam. A kicsapott PCR termékeket 70%-os alkohollal mostam, majd szárítás után 18 µl desztillált vízben oldottam fel. Mivel az amplifikáláshoz használt Pfu polimeráz tompa végeket generál, és a tompa végek ligálási hatékonysága kisebb, mint a túlnyúló végeké, a PCR termék 3 végére egy egybázisos túlnyúló adenozint szintetizáltam Taq polimeráz segítségével. A reakcióelegy összetétele a következő volt: 18 µl visszaoldott PCR termék, 50 mm KCl, 10 mm Tris-HCl, ph 9,0, 0,1% (v/v) Triton X-100, 2,5 mm MgCl 2, 0,2 mm dntp keverék (Fermentas) és 5 egység Taq polimeráz (Zenon). A reakciót 10 percet hagytam zajlani 72 C-on, majd a PCR termékeket 1%-os agaróz gélből való izolálással tisztítottam (Viogene Gel-M Gel Extraction System). A PCR terméket TA-ligálással az egybázisos 5 túlnyúló timidint hordozó pbluescript II KS-T vektorba ligáltam T4 DNS ligáz enzim segítségével. A htry4b_f és a htry4b_r primerek egy NdeI restrikciós endonukleáz hasítóhelyet visznek be a PCR termék 5, illetve egy BamHI helyet a 3 végére, ami lehetővé teszi a gén szubklónozását a T7 promóterrel hajtott pet-15b E. coli expressziós vektorba (Novagen). Ez a konstrukció egy, az N-terminálisán egy hisztidin affinitás címkét hordozó fúziós fehérjét eredményez, mely trombinnal lehasítható a fehérjéről. A klónozott B izoforma szekvenciáját automata didezoxi szekvenálással ellenőriztem, a BigDye Terminator 3.0 Kit-et (ABI Prism) használva. Mivel a humán tripszinogén 4 A izoformájának megfelelő mrns-t nem tudtam izolálni az 5 RACE technikával, ezen izoforma első exonját kódoló DNS szekvenciát genomi DNS-ről amplifikáltam a htry4a_f és htry4a_r oligonukleotidok segítségével, melyek az első exon 5 illetve 3 végére illeszkednek. A genomi DNS-t 200 µl friss teljes vérből izoláltam a GenElute Blood Genomic DNA Kit (Sigma) segítségével a gyártó utasításai szerint. A PCR reakciót Taq polimerázzal végeztem, ami lehetővé tette, hogy a PCR terméket TA ligálással pbluescript II KS-T vektorba klónozzam. A humán tripszinogén 4 A izoformájának első 44 aminosavát kódoló 5 49

50 szekvenciát fuzionáltattam a klónozott B izoformával, ezáltal megkaptam az A izoformát kódoló teljes hosszúságú gént. A fúziót egy természetesen előforduló AlwNI restrikciós endonukleáz felismerőhely tette lehetővé, amely az első exon 3 végén helyezkedik el. Az 5 primer egy NdeI restrikciós endonukleáz felismerőhelyet visz be a PCR termék 5 végére, amit ezáltal ki lehet hasítani a pbluescript vektorból NdeI és AlwnI enzimekkel (Fermentas) történő restrikciós emésztéssel. A kapott fragmenst agaróz gélből való izolálással tisztítottam (Viogene Gel-M Gel Extraction System). A humán tripszinogén 4 B izoformáját hordozó pet-15b vektort AlwNI-gyel emésztettem, majd a keletkező 360, illetve 4000 bázispáros fragmenseket agaróz gélből izoláltam (mivel a gén kettő, a vektor pedig egy további AlwNI hasítóhelyet tartalmaz, ez az enzim három fragmensre hasítja a konstrukciót, melyek mérete 360, körülbelül 2100 és 4000 bázispár). Az izolált AlwNI-NdeI hasított első exont, a 360 bázispáros és a 4000 bázispáros fragmenst egy éjszakán keresztül ligáltam T4 DNS ligáz enzimmel (Fermentas), és az A izoformát kódoló teljes hosszúságú gént Pfu polimerázzal amplifikáltam a htry4a_f és a htry4b_r primerek segítségével. A PCR termék 3 végeire Taq polimerázzal egy-egy adenozint szintetizáltattam, majd a terméket TA ligálással pbluescript II KS-T vektorba klónoztam. A primerek által bevitt NdeI és BamHI hasítóhelyek segítségével a gént pet-15b expressziós vektorba szubklónoztam, ezáltal a gén N-terminálisához fuzionáltattam egy hisztidin affinitás címkét. A klónozott A izoforma szekvenciáját automata didezoxi szekvenálással ellenőriztem. 4.4 A humán tripszinogén 4 mutánsok előállítása A humán tripszin 4 R193G és R193A mutánst Medveczky Péter, míg az R193Y és R193F mutánsokat Gombos Linda bocsátotta rendelkezésemre. Az inaktív humán tripszin 4 mutánst, melyben a katalitikus Ser195-t egy alanin helyettesíti, én állítottam elő. A mutációkat megaprimer PCR mutagenezissel vittük be a génbe a htry4_r193g, htry4_r193a, htry4_r193f, htry4_r193y, htry4_s195a oligonukleotidok segítségével. A PCR reakció során templátként a klónozott humán tripszinogén 4-et használtam pet-17c vektorban. Az első PCR reakcióhoz a mutációt hordozó oligonukleotidot és a gén 3 végére anelláló htry4_3 primert használtam, amely egy SacI restrikciós endonukleáz hasítóhelyet visz be a termékbe. A PCR reakció összetétele a következő volt: 0,2 mm dntp keverék, 0,2 µm mutációt hordozó primer, 50

51 0,2 µm htry4_3 primer, ~ 1 ng miniprep templát DNS, 2,5 egység Pfu polimeráz (Fermentas) 20 mm Tris-HCl, ph 8,8, 10 mm (NH 4 ) 2 SO 4, 10 mm KCl, 0,1% (v/v) Triton X-100, 0,1 mg/ml marha szérum albumin, 2 mm MgSO 4 összetételű pufferben. A PCR reakció hőprofilja a következő volt: 95 C 3 perc kezdeti hődenaturáció, majd 27 ciklus 95 C 45 másodperc hődenaturáció, 55 C 45 másodperc anelláció, 72 C 30 másodperc lánchosszabbítás, az utolsó ciklust követően pedig 72 C 3 perc. A szintetizált, mutációkat hordozó megaprimereket 2%-os agaróz gélből való izolálással tisztítottam (Viogene Gel-M Gel Extraction System), és a második PCR reakcióban primerként használtam a gén 5 végére anelláló htry4_5 oligonukleotid mellett, amely egy HindIII restrikciós endonukleáz hasítóhelyet visz be a PCR termék 5 végére. A teljes, mutáns gén amplifikálásakor a reakció összetétele (a primerek kivételével) megegyezett az első PCR összetételével. A hőprofilt annyiban módosítottam, hogy a lánchosszabbítás 72 C-on 60 másodperc volt, tekintettel a hosszabb PCR termékre. A PCR termékeket 1%-os agaróz gélen futtattam, majd 2,5 térfogat jéghideg abszolút etanollal való kicsapással tisztítottam. A kicsapott PCR termékeket 70%-os alkohollal mostam, majd szárítás után 18 µl desztillált vízben oldottam fel. A PCR termékek 3 végeire Taq polimerázzal egy-egy adenozint szintetizáltattam, majd a terméket TA ligálással pbluescript II KS-T vektorba klónoztam. A primerek által a gén 5 illetve 3 végére bevitt HindIII illetve SacI restrikciós endonukleáz hasítóhelyek felhasználásával a mutáns géneket pet-17c expressziós vektorba szubklónoztam T4 DNS ligáz enzim segítségével. Az előállított konstrukciókat E. coli DH5α törzsébe transzformáltam, majd a 2YT médiumban felnövesztett kultúrákból plazmid DNS-t alkalikus lízist követően szilikagél oszlopon tisztítottam (Viogene Mini-M Kit). 4.5 A rekombináns fehérjék előállításához használt pet E. coli expressziós rendszer működése A munkához használt rekombináns fehérjéket a pet expressziós rendszerrel állítottam elő E. coliban. A rendszerben a célgént az erős bakteriofág T7 transzkripciós és transzlációs szignál által kontrollált pet plazmidba klónozzuk. Az expresszió a gazdasejtben a T7 RNS polimeráz forrás biztosításával indukálható. A célgént hordozó pet plazmidot expressziós gazdasejtbe visszük be, amely a T7 RNS polimeráz génjét a 51

52 lacuv5-ös promóter kontrollja alatt hordozza a kromoszómális DNS-ében (λde3 lizogén gazda), és az expresszió izopropil-β-d-tiogalaktopiranoziddal (IPTG) indukálható. A legáltalánosabban használt λde3 lizogén törzs a BL21, amely deficiens a lon és az ompt proteázra nézve. A humán tripszinogén 4 rekc izoforma termeléséhez az E. coli BL21(DE3)pLysS törzsét, az A és B izoforma expresszálásához pedig a Rosetta (DE3)pLysS (Novagen) törzset használtam a magasabb kitermelés érdekében. Ez utóbbi törzs egy kloramfenikol rezisztenciát okozó plazmidon hordoz 6 ritka kodont (AUA, AGG, AGA, CUA, CCC, GGA) felismerő trns génjét, ezáltal nagyobb mennyiségben képes olyan eukarióta fehérjék termelésére, amelyek ritka kodonokat tartalmaznak. A plys plazmid a T7 lizozimet kódolja, ami természetes inhibitora a T7 RNS polimeráznak, így csökkenti az RNS polimeráz transzkripcióját a nem-indukált állapotban. 4.6 A rekombináns humán tripszinogén 4 izoformák és mutánsok expressziója, a fehérjék tisztítása és aktiválása A magnéziumklorid-kalciumklorid kezelés hatására kompetenssé tett E coli BL21(λDE3)pLysS és Rosetta (λde3)plyss sejteket hősokk segítségével transzformáltam a konstrukciókkal. A transzformált sejtekből 500 ml kultúrát növesztettem 37 C-on Luria-Bertani médiumban 200 µg ampicillin mellett, amíg a 600 nm-en mért optikai denzitás értéke elérte a 0,6-et. Ekkor a sejtkultúrákat indukáltam 0,4 mm izopropil-β-d-tiogalaktopiranozid hozzáadásával, majd további 4 órán át inkubáltam őket a 37 C-os rázótermosztátban. A sejteket centrifugálással gyűjtöttem össze (8000 RPM, 20 perc), majd 40 ml 0,1 M Tris-HCl, ph 8,0, 2 mm EDTA 1% Triton X-100 oldatba szuszpendáltam fel és szonikálással segítettem elő a sejtek lízisét. Az expresszált fehérjék zárványtest formájában termelődtek. A zárványtesteket háromszor mostam a fenti oldat 50 ml-ével, majd kétszer detergens nélküli pufferrel. A kapott csapadékot 4 ml 30 mm DTT, 6 M guanidin-hidroklorid, 0,1 M Tris-HCl, ph 8,5 és 2 mm EDTA összetételű oldatban oldottam fel, és egy órán át redukáltam 37 C-on. A fel nem oldódó szennyeződéseket (pl. sejtfal törmelék) ultracentrifugálással távolítottam el (45000 RPM, 30 perc). A denaturált és redukált tripszinogéneket cseppenként higítottam ki 125 ml 4 C-os, levegőtlenített renaturáló pufferbe (0,9 M guanidin hidroklorid, 0,1 M Tris-HCl, ph 8,5, 2 mm EDTA, 1 mm L-cisztein, és 1 mm 52

53 L-cisztin). Az A és a B izoforma esetén a renaturáló pufferből elhagytam az EDTA-t, hogy a továbbiakban az affinitás kromatográfiát el tudjam végezni a nikkel-oszlopon. A fehérjét tartalmazó renaturáló puffert lassan kevertettem N 2 gáz alatt egy éjszakán át 4 C-on. A tripszinogén oldatokat 2,5 mm sósavval szemben dializáltam, majd a kicsapódott fehérjéket centrifugálással távolítottam el. A humán tripszinogén 4 A és B izoformáját az N-terminális hisztidin címke segítségével nikkel-nitrilotriecetsav oszlopon tisztítottam natív körülmények között (Ni- NTA His-Bind Superflow oszlop, Novagen) a gyártó utasításai szerint. A fehérjéket imidazollal eluáltam az oszlopról. Szükség szerint a zimogéneket átdializáltam 2,5 mm sósavba. A hisztidin affinitás címkét a célfehérjéhez milligrammonként 0,5 egység trombint adva (Thrombin Cleavage Capture Kit, Novagen) 20 mm Tris-HCl, ph 8,4, 150 mm NaCl, 2,5 mm CaCl 2 összetételű pufferben hasítottam le szobahőmérsékleten 2 órán át való inkubálással. A zimogének koncentrációját a 280 nm-en mért elnyelésük alapján számoltam az elvi moláris extinkciós koefficiensek segítségével (A izoforma: ε 280 = M -1 cm -1, B izoforma: ε 280 = M -1 cm -1, rekc izoforma és 193-as pozícióban mutáns variánsai: ε 280 = M -1 cm -1 ). A zimogének korrekt térszerkezetének kialakulását redukáló és nem redukáló közegben végzett 15%-os SDS poliakrilamid gélelektroforézissel (Laemmli 1970) ellenőriztem. A tripszinogéneket 1:1000 moláris arányban hozzáadott sertés enterokinázzal (Sigma) aktiváltam 50 mm Tris-HCl, ph 8,0, 100 mm NaCl, 10 mm CaCl 2 pufferben 37 C-on 1 órán át, affinitás kromatográfiával tisztítottam benzamidin-sepharose oszlopon majd 10 mm sósavval eluáltam. A fehérjét tartalmazó frakciókat egyesítettem, ultraszűréssel töményítettem, és aliquotokban -20 C-on tároltam. A ph-ugrásos kísérletekhez az enzimeket 500 térfogatnyi hideg 2,5 mm sósavval szemben dializáltam egy éjszakán át. A fehérjék koncentrációját MUGB-al történő aktívhely titrálással (Jameson és mtsi. 1973), illetve a 280 nm-en mért elnyelésük alapján számoltam az ε 280 = M -1 cm -1 elvi moláris extinkciós koefficiens segítségével. A preparátumok tisztaságát 15% SDS poliakrilamid gélelektroforézissel ellenőriztem (Laemmli 1970). 4.7 Membránkötési kísérletek A humán tripszinogén 4 A, B, illetve rekc izoformájának membránkötő képességét precipitációs kísérletekkel vizsgáltam. A preparált membránfrakciókat 53

54 Énekes Vilmosné bocsátotta rendelkezésemre. A membránfrakció preparálásához egy kb. 2 g súlyú patkányagyat elhomogenizált 4 ml 35 mm Tris-HCl, ph 7,2-7,6, 25 mm KCl, 5 mm MgCl 2, 10,2% (m/m%) szacharóz pufferben. A puffer tartalmazott 50 µg/ml fenilmetilszulfonil fluorid, 2 µg/ml benzamidin, 2 µg/ml cisztatin, 2 µg/ml aprotinin összetételű inhibitorkoktélt is. A szövethomogenizátum térfogatát kiegészítette a fenti pufferrel 10 ml-re, majd 600 g-vel 10 percet centrifugálta. A kapott felülúszót tovább centrifugálta 7500 g-vel 10 percet, majd ezt a lépést megismételte. A kapott felülúszót g-vel centrifugálta 45 percet. Az így megkapott csapadék a mikroszóma frakció, amely tartalmazza a plazmamembránt, a Golgi apparátust, a sima és a durva ER-t. Ez a membránfrakció tovább frakcionálható sűrűséggradiens centrifugálással. Ebből a célból a kapott mikroszóma csapadékot 3-5 térfogat homogenizáló pufferben szuszpendálta fel, majd centrifugacsőben alárétegzett 4-4 ml 45, 40, 35, 30 és 25% szacharózt tartalmazó puffert. A mintát a cukorgradiensen 16 órán át fugálta g-vel, majd a szétvált membránfrakciókat külön centrifugacsövekbe szedte, és a megfelelő koncentrációjú szacharózt tartalmazó pufferrel, majd ezután 25 mm Tris-HCl, 150 mm NaCl oldattal mosta. Az így kapott 25%-os szacharózt tartalmazó frakcióban található az izolált plazmamembrán. Membránkötési kísérleteimet a mikroszóma frakcióval, illetve az ebből tovább frakcionált plazmamembrán preparátummal végeztem, mivel ELISA mérések (ld fejezet) alapján ezek a frakciók tartalmaztak endogén módon humán tripszinogén 4-et µl izolált mikroszóma illetve plazmamembrán frakcióhoz 3-25 µg rekombináns humán tripszinogén 4 A, B illetve rekc izoforma fehérjét adtam 50 mm Tris-HCl, ph 8,0 pufferben. A fehérje kontroll mintákban a membrán frakciót desztillált víz helyettesítette, a mikroszóma kontroll mintába pedig a rekombináns fehérje helyett desztillált vizet tettem. A mintákat 1,5 órán át inkubáltam 37 C-on, majd RPM-el centrifugáltam 1 órán át. A csapadékban megkapott membrán frakciót 15 µl desztillált vízben szuszpendáltam fel, majd nem-redukáló SDS-mintapufferrel (125 mm Tris-HCl, ph 6,5, 20% glicerin, 2% SDS, 0,01% brómfenolkék) kezeltem. A felülúszóból a fehérjéket egynegyed térfogat 100%-os triklórecetsavval kicsaptam, a csapadékot kétszer mostam acetonnal, szárítás után 15 µl desztillált vízbe oldottam vissza, majd nem-redukáló SDS-mintapufferrel kezeltem. Hogy megvizsgáljam, nagy ionerejű oldattal eluálhatók-e a megkötődött fehérjék a membránokról, a csapadékot 1 mintatérfogat 0,1 illetve 1 M NaCl oldatban szuszpendáltam fel, majd a fentiekhez hasonlóan centrifugáltam, csaptam ki és kezeltem a mintákat. A mintákat 5 percig 54

55 forraltam, majd µl mintát 15%-os SDS poliakrilamid gélen futtattam diszkontinuus pufferrendszerben (Laemmli 1970). A megfuttatott géleket nitrocellulóz membránra blottoltam át 25 mm Tris, 188 mm glicin, 20% (v/v) metanol összetételű blottpufferben. A nitrocellulóz membránt ezután 30 percig inkubáltam 20 mm Tris-HCl, ph 8,0, 150 mm NaCl, 0,05% Tween-20 pufferben, hogy blokkoljam a detergenssel az aspecifikus kötőhelyeket a nitrocellulóz membránon. Az ellenanyagokat ugyanilyen összetételű pufferben higítottam. Az egyes ellenanyagokkal 1-1 órát inkubáltam a membránt szobahőmérsékleten. Az egyes ellenanyagok között a nitrocellulóz membránról háromszori mosással távolítottam el a meg nem kötődött, feleslegben lévő ellenanyag molekulákat. Az elsődleges ellenanyag egy monoklonális anti-proteáz domén ellenanyag volt, melyet 1000-szeres hígításban alkalmaztam. Kétlépcsős Western blot esetén a másodlagos ellenanyag peroxidáz konjugált anti-egér IgG ellenanyag (Sigma) volt 2000-szeres hígításban alkalmazva. Háromlépcsős rendszer esetén a másodlagos ellenanyag biotinilált anti-egér IgG (Sigma) volt 1/2000-szeres hígításban, majd a harmadik lépcsőben 2000-szeres hígításban adott sztreptavidin konjugált peroxidázt (Sigma) alkalmaztam. A blot előhívása előtt a membránokat 20 mm Tris-HCl, ph 8,0, 150 mm NaCl pufferrel mostam, hogy eltávolítsam a detergenst. A blot hívását 20 mm Tris-HCl, ph 8,0, 150 mm NaCl pufferben 25 µl hidrogén peroxid, 0,4 mm NiCl 2 és 0,5-1 mg/ml diamino benzidin kromogén szubsztrát hozzáadásával végeztem. A színreakciót addig hagytam zajlani, míg kellően erős jeleket kaptam, majd a reakciót a fenti puffert desztillált vízre cserélve állítottam le. 4.8 Steady state kinetikai mérések: A k cat és a K m meghatározása A k cat és a K m mérési adatait Medveczky Péter bocsátotta rendelkezésemre. A méréseket 0,5-2 nm enzimmel végezte Z-Gly-Pro-Arg-pNA szubsztráton 50 mm Tricin, ph 8,0, 10 mm CaCl 2 pufferben 20,0 C-on. A szubsztrát törzsoldatokat dimetilformamiddal készítette, és a dimetilformamid végkoncentrációja a reakciókban kisebb volt, mint 1%. A szubsztrát hidrolízisét a paranitroanilin termék keletkezésnek 405 nm-en való mérésével követte egy Shimadzu UV-2101PC spektrofotométeren. A kezdeti sebességet hat különböző szubsztrátkoncentrációnál mérte meg a µm-es koncentráció tartományban. Minden adatpont esetében három párhuzamos mérés 55

56 történt. A mért kezdeti sebességeket ábrázolta a szubsztrátkoncentráció függvényében, majd a k cat, K m és k cat /K m értékeket az ábrázolt pontokra illesztett hiperbolák paramétereiből számolta. 4.9 Tranziens kinetikai mérések Gyorskinetikai mérések 4-metilumbelliferil 4-guanidinobenzoát szubsztráton A stopped flow tranzienseket egy 450 wattos super-quiet Hg-Xe lámpával (Hamamatsu) felszerelt KinTek SF-2004 készülékkel (KinTek) vettem fel. A gerjesztési hullámhossz 365 nm volt 0,5 nm résszélességgel, az emissziós oldalon egy WG420 nm-es vágószűrőt (Comar Instruments) használtam. 8 ml/másodperc áramlási sebességet alkalmaztam, 40 µl térfogatú mintákat keverve össze 1:1 keverési arányban. A fluoreszcencia emisszió intenzitását egy 700 V feszültségre állított fotoelektronsokszorozóval mértem. A stopped flow készülék holtideje 1,0 milliszekundum. A szubsztráttelítés vizsgálatához 0,1 µm enzimet kevertem össze 0, µm illetve 0, µm 4-metilumbelliferil 4-guanidinobenzoát szubsztrát analóggal a vad típusú, illetve az R193G mutáns humán tripszin 4 esetén (a megadott koncentrációk a keverés után a reakciótérben kialakuló végső koncentráció értékek). A reakciót 20 mm Tricin ph 8,0, 10 mm CaCl 2 összetételű pufferben mértem 20,0 C-on. Az adatokat logaritmikus időskálán vettem fel, így biztosítva, hogy elegendő adatpontot gyűjtsek akár többfázisú folyamat analíziséhez is. Többfázisú reakció esetén a logaritmikus időskálán való adatgyűjtéskor az egyes fázisok kiegyensúlyozottabban lesznek reprezentálva a mérési pontok által. Az analizált görbék 4-7 felvett időgörbe átlagai. A reakció termodinamikai tulajdonságainak vizsgálatához 0,1 µm enzimet kevertem össze telítési koncentrációjú szubsztráttal (500 µm-lal a vad típusú enzim esetén és 200 µm-lal az R193G mutáns enzimnél) és a reakció lefolyását különböző hőmérsékleteken 3 C-onként követtem a 6-36 C-os hőmérsékleti tartományban. A reakciót 20 mm Tricin, ph 8,0 ± 0,1, 10 mm CaCl 2 pufferben végeztem. A pka/10 ºC = -0,21 összefüggés ismeretében a Tricin pufferek ph-ját szobahőmérsékleten 7,6-8,2-56

57 re állítottam be, hogy a különböző mérési hőmérsékleteken a ph értéke 8,0 ± 0,1 legyen. A továbbiakban a nem 20 C-on történt méréseknél a ph értékét ± 0,1-es pontossággal adom meg A 4-metilumbelliferil 4-guanidinobenzoát reakciók kinetikai és termodinamikai elemzése A reakciókat a felvett görbékre való kettős exponenciális függvények illesztésével elemeztem a KinTek szoftver és az OriginLab v7.5 program (MicroCal Software) segítségével. Az adatokat korrigáltam a szubsztrát spontán hidrolízisével, ami magas hőmérsékleteken jelentős volt. Az elemi sebességi állandók számolásának levezetését az fejezetben tárgyalom. Az aktivációs paramétereket az ln (k/t) 1/T függvényében való ábrázolásának (Eyring ábrázolás) elemzéséből számoltam az 1. egyenlet szerint (Keleti 1983), ahol k a sebességi állandó, R az univerzális gázállandó (8,314 Jmol -1 K -1 ), T az abszolút hőmérséklet, N A az Avogadro szám, h a Planck állandó, az aktiválási entalpia H = -meredekség 8,314 Jmol -1 és az aktiválási entrópia S = (tengelymetszet 23,76) 8,314 Jmol -1 K -1. Az aktiválási szabadenergiát ( G ) a 2. egyenlet segítségével számoltam. ln (k/t) = ln (R/N A h) + S /R - H /RT G = H - T S 1. egyenlet 2. egyenlet Az egyensúlyi standard szabadenergia változást ( G ) a 3. egyenletből számoltam ki. A standard entalpia ( H ) és entrópia ( S ) változásokat a linearizált van t Hoff ábrázolásokból vezettem le a 4. egyenletnek megfelelően. G = - RTln K ln K = S /R - H /RT 3. egyenlet 4. egyenlet 57

58 4.9.3 ph-ugrásos stopped flow mérések A triptofánokat 297 nm-en gerjesztettem 2 nm-es résszélességgel, és a fluoreszcencia emissziót egy 700 V feszültségre állított fotoelektronsokszorozóval detektáltam egy 340 nm-es interferenciaszűrőn (Comar Instruments) keresztül. 12 ml/sec áramlási sebességet alkalmaztam, és 40 µl térfogatú mintákat kevertem össze 1:1 arányban. 1-4 µm 20 mm CABS, ph 11,0, 10 mm CaCl 2 pufferben lévő enzimet összekevertem 100 mm Tricin, ph 8,0, 10 mm CaCl 2 pufferrel, és követtem a fluoreszcencia emisszió intenzitásának növekedését. A konformációváltozás sebességét a 6-38 C-os hőmérsékleti tartományban 3 C-onként a hagyományos stopped flow készülékkel mértem. A pufferek ph-ját szobahőmérsékleten különböző értékekre állítottam be úgy, hogy a ph 8,0 ± 0,1 (illetve ph 11,0) legyen a különböző mérési hőmérsékleteken Hőugrásos stopped flow ph-ugrás mérések A méréseket a Málnási-Csizmadia András laborjában kifejlesztett hőugrásos stopped flow készülékkel mértem (Kintses és mtsi. 2006). Az enzimet 20 C-on tartottam a ph 8,0-es pufferrel való összekeverésig, mely egy fűtött csövön folyik át. A küvetta hőmérsékletét egy másik fűtőelem szabályozza (Supertech Kft), biztosítva, hogy a keverék és a reakciótér hőmérséklete azonos legyen. 20 µl 20 mm CABS, ph 11,0, 10 mm CaCl 2 pufferben lévő enzimet kevertem össze 100 µl 100 mm Tricin, ph 8,0, 10 mm CaCl 2 pufferrel, és detektáltam a fluoreszcencia emisszió intenzitásának változását. A pufferek ph-ját szobahőmérsékleten állítottam be úgy, hogy az adott mérési hőmérsékleten a kívánt értéket adják. Az 1:5 arányú keverés nagyobb hőmérsékletugrást tesz lehetővé, ugyanakkor az enzim nem-denaturáló hőmérsékleten tartható a reakció kezdetéig. Az alkalmazott hőmérsékleti tartományban a fűtött csövet és a küvettát is magasabb hőmérsékletűre fűtöttük az elvi képlet alapján számolható értékhez képest ((1 20 C + 5 T cső)/6 = T küvetta), hogy kompenzáljuk a rendszer hőveszteségét. A készülék hőmérsékleti kalibrálását az N-acetil L-triptofán amid (NATA) fluoreszcencia intenzitásának a hőugrással előállított különböző hőmérsékleteken való mérésével végeztük. A fűtött cső és a küvetta hőmérsékletét úgy 58

59 állítottuk be, hogy a keverés után a NATA fluoreszcenciájának intenzitása ne változzon, ami arra utal, hogy a keverék hőmérséklete azonos volt a küvetta hőmérsékletével. A készülék legfőbb előnye, hogy a gyors hőugrás egyidőben történik a reaktánsok összekeverésével, ezáltal a holtidő nem nő meg egy konvencionális stopped flow készülékhez képest. Az új hőugrásos stopped flow készülékkel tanulmányozható a reakciók kinetikája magas hőmérsékleten, akár a fehérje denaturációs hőmérséklete felett is, ha a követett reakciólépések gyorsabbak, mint az általában lassú hődenaturációs reakció A sebességi állandók relatív külső viszkozitástól való függésének meghatározása A stopped flow méréseket 20 C-on végeztem 10 mm CABS, ph 11,0, 5 mm CaCl 2, és 50 mm Tricin, ph 8,0, 5 mm CaCl 2, pufferekben, melyeket maltózzal egészítettem ki, hogy különböző relatív viszkozitású oldatokat kapjak. Maltózt alkalmaztam a viszkozitás növelésére 0-1,46 M-os koncentrációban, ami 1-8,2-es relatív viszkozitást eredményez (Wheast (szerk.) 1988). A maltóz növeli meg a legnagyobb mértékben a relatív viszkozitást az oldat dielektromos állandójának legenyhébb (17,5%-al való) csökkentése mellett, összehasonlítva más, gyakran használt viszkozitásnövelő anyagokkal, pl. a fruktózzal, illetve az etilén glikollal. A pufferek koncentrációját csökkentettük az egyéb mérésekben alkalmazott pufferekéhez képest, mivel az ionerősség befolyásolja a viszkozitást. A többi kísérleti beállítás azonos volt a fejezetben leírtakkal A ph-ugrásos mérések kinetikai és termodinamikai analízise 5-8 felvett időgörbét átlagoltam és egyszeres vagy kettős exponenciális függvénnyel való illesztéssel elemeztem a KinTek (KinTek Corp.) illetve az OriginLab v7.5 (MicroCal Software) program segítségével. A megfigyelt sebességi állandókat (observed rate constants) (k) ábrázoltam a hőmérséklet (T) függvényében, majd a termodinamikai profilokat az y = a exp( b/ x) exponenciális függvény illesztésével 59

60 elemeztem. Az illesztett függvény egyes paraméterei közvetlenül megfeleltethetők az Arrhenius egyenlet paramétereinek linearizálás nélkül (y = k, a = A, b = -E a /R, x = T). A reakciók sebességi állandójának hőmérsékletfüggését az Arrhenius egyenlet írja le (Arrhenius 1889): k = Aexp( E / RT ) 5. egyenlet a ahol k a sebességi állandó, A a preexponenciális tag, E a a folyamat aktiválási energiáját jelöli, R a gázállandó és T az abszolút hőmérséklet. A Kramers elmélet egy konvencionális megközelítés a súrlódás (friction) egymolekulás reakciók sebességi állandóira való hatásának jellemzésére a folyadék fázisban (Kramers 1940). Ebben a modellben a kémiai reakciót egy olyan részecske modellezi, amely diffúziós egydimenziós mozgást végez egy potenciálgödörből egy energiagáton keresztül. A Kramers elmélet alapján az Arrhenius egyenlet preexponenciális tagja tartalmaz egy súrlódási (friction) paramétert, amelyet döntően a viszkozitás határoz meg, és a sebességi állandó fordítottan arányos ezzel a súrlódási paraméterrel. Ansari és munkatársai (Ansari és mtsi. 1992) ezt a megközelítést módosították fehérjékre vonatkoztatva a súrlódást felosztva két forrásra. A két tagból az egyik az oldószer súrlódása (külső súrlódás) (friction of the solvent, external friction) ami mérsékli az atomok mozgását a fehérje felszínén. A másik tag pedig a fehérje belső súrlódása (internal friction), ami akadályozza a fehérje atomjainak mozgását egymáshoz képest. A modell leírására a következő egyenletet állították fel: C k = exp( E σ + η a / RT ) 6. egyenlet ahol η a külső (oldószer) viszkozitás és σ egy viszkozitás dimenziójú paraméter, amely meghatározza a fehérje belső súrlódását (internal friction). A továbbiakban ezt a paramétert belső viszkozitásként (internal viscosity) említem. C pedig magába foglalja a viszkozitás-független paramétereket. Az oldószer súrlódása a Stokes törvény alapján arányos az oldószer viszkozitásával. Ennek az analógiának az alapján a molekula belső súrlódását (internal molecular friction) nevezhetjük a fehérje belső viszkozitásának, és ennek a viszkozitás-szerű paraméternek viszkozitás-dimenziója van (Tóth és mtsi. 60

61 2006c). Mindazonáltal ez nem tekinthető a fehérje egy általános paraméterének, hanem mindig egy specifikus konformációváltozáshoz kapcsolt a fehérjében. Feltételezve, hogy az aktiválási energia nem függ a viszkozitástól állandó hőmérsékleten, a 6. egyenlet a következőképpen módosul: C' = σ +η k 7. egyenlet melyben C magába foglalja a C exp( E / RT ) kifejezést. A 7. egyenlet linearizált alakja a következő lesz: a 1 k η σ = + 8. egyenlet C' C' Ennek következményeként az 1/k-t ábrázolva a külső viszkozitás függvényében egy lineáris függvényt kapunk, és a fehérje lokális belső viszkozitása levezethető az egyenes tengelymetszetéből azt megszorozva a meredekség reciprokával (Tóth és mtsi. 2006c). Másképpen megfogalmazva, állandó hőmérsékleten a belső súrlódás kiszámolható a sebességi állandó nulla külső viszkozitásra (η = 0 cp) való extrapolálásával: C' σ = η k 9. egyenlet Ezért a konformációváltozás sebességét megmérve a puffer relatív viszkozitásának függvényében a fehérje lokális belső viszkozitása meghatározható. 61

62 5. EREDMÉNYEK ÉS ÉRTELMEZÉSÜK 5.1 A humán tripszinogén 4 mrns 5 végi szekvenciájának meghatározása 5 RACE PCR-rel Humán frontális kéreg, hippocampus és kisagykéreg mintákból a humán tripszinogén 4 mrns 5 végi szekvenciájának meghatározása céljából totál RNS-t izoláltam, amit templátként használtam cdns szintéziséhez. A kapott cdns-t 5 RACE technikával amplifikáltam. Egy, a kísérletek során kapott tipikus PCR termék gélelektroforetikus képe a 7. ábrán látható. 7. ábra Egy agyszövetből izolált 5 RACE PCR termék gélelektroforetikus képe. A molekulasúly marker (GeneRuler 1kb DNA Ladder, Fermentas) melletti számok az egyes fragmensek bázispárjainak számát jelölik. A kapott PCR termékeket agaróz gélből izoláltam, majd pbluescript vektorba klónoztam és szekvenálással karakterizáltam. Az izolált leghosszabb szekvenciák közül néhányat a 8. ábrán mutatok be. 62

63 -44 N-term. peptid M C G P D D R C P A R W P G P G R A V K ATGTGCGGACCTGACGACAGATGCCCCGCACGCTGGCCGGGACCGGGAAGGGCGGTCAAG N-term. peptid C G K G L A A A R P G R V E R G G A Q R TGTGGAAAGGGTCTGGCGGCTGCCAGGCCTGGCAGAGTGGAGCGGGGCGGGGCGCAGCGG N-term. peptid G G A G L E L H P L L G G R T W R A A R GGCGGGGCGGGCCTGGAGCTGCACCCGCTTCTGGGTGGACGCACTTGGCGAGCGGCGCGG GGCCTGGAGCTGCACCCGCTTCTGGGTGGACGCACTTGGCGAGCGGCGCGG CACTTGGCGAGCGGCGCGG TGGCGAGCGGCGCGG N-term. peptid G C D A D E A L G T V A V P F D D D D K GATGCAGACGGCTGCGAGGCGCTGGGCACAGTTGCTGTCCCCTTTGACGATGATGACAAG GATGCAGACGGCTGCGAGGCGCTGGGCACAGTTGCTGTCCCCTTTGACGATGATGACAAG 2. GATGCAGACGGCTGCGAGGCGCTGGGCACAGTTGCTGTCCCCTTTGACGATGATGACAAG 3. GATGCAGACGGCTGCGAGGCGCTGGGCACAGTTGCTGTCCCCTTTGACGATGATGACAAG CTGCGAGGCGCTGGGCACAGTTGCTGTCCCCTTTGACGATGATGACAAG 8. ábra Néhány agyi mintából izolált humán tripszinogén 4 cdns 5 végi szekvencia (1-4.) összerendezve a prediktált teljes hosszúságú cdns-el (N-terminális peptid). A legfelső sorban az N- terminális peptid szekvenciája és a propeptid aminosavsorrendje látható az aktivációs domén határáig. Vastag betűkkel kiemelve a potenciálisan transzlációs startkodonként szolgáló tripleteket, illetve az általuk kódolt kezdő aminosavat ábrázoltam. Pirossal kiemeltem az alternatív starthelyként szolgáló +1-es pozíciójú leucint, és az azt kódoló CTG bázishármast. A szekvenciákat ClustalW programmal (Thompson és mtsi. 1994) rendeztem össze. A bemutatott tipikus szekvenciák különböző hosszúságú szakaszt tartalmaznak a humán tripszinogén 4 N-terminális szekvenciájából. A leghosszabb izolált cdns (1. szekvencia) tartalmazza a potenciális alternatív transzkripció iniciációs starthelyként szolgáló CUG kodont (az ábrán pirossal kiemelve), mely egy leucint kódol (Leu+1). Eredményeimet megerősíti a Wiegand és munkatársai által izolált szekvencia, amely gyakorlatilag azonos az általam karakterizált cdns 5 végével (Wiegand és mtsi. 1993). A prediktált 72 aminosav hosszúságú, metioninnal (Met-44) kezdődő N-terminális peptiddel rendelkező A izoformának megfelelő cdns-t többszöri próbálkozás ellenére sem tudtam izolálni. Az izolált cdns 5 vége (8. ábra 1. szekvencia) nem egy valódi 63

64 eukarióta mrns 5 vég, hiszen nem tartalmazza az 5 nem-transzlálódó régiót. Bár post mortem szöveti mintákkal való munkák esetén nem zárható ki az RNS degradáció lehetősége, az izolálást elvégezve a humán tripszinogén 4-et endogén módon termelő Caco2 humán vastagbél adenokarcinóma sejtvonalból (Cottrell és mtsi. 2004), ahol élő sejtekből késleltetés nélkül végezhető el az RNS izolálás, hasonló szekvenciákat kaptam. Eredményeimet alátámasztják kutatócsoportunk más tagjainak munkája is, melynek célja az agyszövetben expresszált fehérje N-terminális aminosavainak azonosítása volt. Kutatócsoportunkban Medveczky Péter humán agyi extraktumból immunaffinitás kromatográfiával a humán tripszin 4 és a humán tripszinogén 4 B izoformájának 28 tagú aminoterminális peptide ellen termelt monoklonális antitestekkel reagáló fehérjéket izolált, majd azokat N-terminális aminosav analízissel azonosítottuk (Németh és mtsi. 2006, kézirat bírálat alatt). Ezen kísérletekben szintén a B izoformát tudtuk izolálni, a hosszabb A izoformának megfelelő fehérje nem volt kimutatható. A B izoforma A izoformából proteolítikus hasadással való keletkezését kontroll kísérlet segítségével kizártuk. Tehát mrns és fehérje szinten egyaránt az agyszövetben nagy valószínűséggel a rövidebb, leucin kezdő aminosavval rendelkező izoforma a domináns, illetve kizárólagos előfordulású. A CUG kodonról való alternatív transzláció iniciáció emlős sejtekben megtörténik, és a kezdő aminosav valóban leucin, ahogy azt munkacsoportunkban Németh Attila igazolta HeLa epitheliális adenokarcinóma illetve U87 glioblasztóma sejteket tranziensen transzfektálva a humán tripszinogén 4 különböző konstrukcióival (9. ábra) (Németh és mtsi. 2006, kézirat bírálat alatt). A transzfektált sejtek által termelt fehérjéket immunaffinitás kromatográfiát követő N-terminális aminosav szekvenálással azonosítottuk. Ez a kísérleti rendszer lehetővé tette az alternatív transzkripció iniciáció vizsgálatát jelentősen kisebb valószínűségű RNS, illetve fehérje degradáció mellett, ami komoly technikai problémát jelent a post mortem humán agyszöveti mintákkal való munkáknál. Továbbá, mivel irányított mutagenezis segítségével pontmutációkat, illetve deléciókat lehet bevinni a konstrukciókba, vizsgálhatóvá válik az egyes tripletek, illetve génszakaszok szerepe a humán tripszinogén 4 expressziójában. 64

65 9. ábra A: Az eukarióta sejtek transzfekciójához használt konstrukciók vázlatos felépítése, kiemelve a transzláció iniciációs helyként szolgáló kodonokat és a 28, illetve 72 aminosav hosszúságú N-terminális peptidet (piros). Az aktivációs peptidet és a proteáz domént kódoló génszakaszt lilával jelöltük. p72 M T4: a 72 tagú N-terminális peptidet hordozó, a -44-es pozícióban AUG startkodonnal, a +1-es pozícióban CUG kodonnal rendelkező humán tripszinogén 4-et kódoló konstrukció. p28 L T4: a 72 tagú N-terminális peptidet hordozó, a +1-es pozícióban CUG kodonnal rendelkező humán tripszinogén 4-et kódoló konstrukció, melyből a -44-es pozícióban az AUG startkodot delécióval eltávolítottuk. A deléció miatt nem transzlálódó régiót fehér színnel jelöltük. B: a p72 M T4 konstrukcióról expresszált, izolált fehérje N-terminális szekvenciája C: a p28 L T4 konstrukcióról expresszált, izolált fehérje N-terminális szekvenciája. Az ábra Németh és mtsi. kéziratában (2006) található ábra módosításával készült. Az A izoformát kódoló konstrukcióval (p72 M T4) (9. ábra) való transzfektálás esetén az immobilizált ellenanyag segítségével izolálni lehetett a hosszabb, 72 aminosavból álló N-terminális peptiddel rendelkező szekvenciát is a B izoforma mellett (9. ábra B). Ez esetben az első AUG-ről történő transzláció iniciáció oka lehet az, hogy a transzfektált sejtekben a transzkripció igen erős virális promóterről (humán citomegalovírus promóter) történik, így olyan fehérje is termelődhet, ami fiziológiás körülmények között nem expresszálódik. Eltérőek lehetnek a sejtvonalakban, illetve az agyszövetben jelen lévő transzkripciós faktorok és a transzkripcióhoz, illetve a transzlációhoz szükséges egyéb fehérjekészletek is. A B izoformát kódoló konstrukcióval (p28 L T4) transzfektált sejtekből izolálható fehérje a vártnak megfelelően leucin kezdő aminosavval rendelkezett (9. ábra C). Számos különböző C-terminális GFP-fúziós humán tripszinogén 4 konstrukció készült, melyekben ATG, illetve CTG triplettel kezdődő 72, illetve a 28 tagú N-terminális szekvencia előzte meg a proteáz domént kódoló génszakaszt. A következőkben leírt kísérletekhez használt konstrukciók vázlatos felépítését a 10. ábrán mutatom be. 65

66 10. ábra Az emlős sejtek transzfektálásához használt néhány GFP-fúziós humán tripszin 4 konstrukció vázlatos felépítése, kiemelve a transzláció iniciációs startként szolgáló bázishármasokat (-44ATG, +1CTG/ATG) és az N-terminális peptidet kódoló génszakaszt (piros). Az aktivációs peptidet és a proteáz domént kódoló DNS szekvenciát lilával, a GFP-t kódoló szakakaszt pedig zölddel jelöltem. p72 M T4-GFP: a -44-es pozícióban ATG tripletet tartalmazó C-terminális GFP-fúziós humán tripszinogén 4 A izoforma; p28 L T4-GFP: C-terminális GFP-fúziós humán tripszinogén 4 A izoforma, melyben a -44-es pozíciójú ATG bázishármast delécióval eltávolították; p28 M T4-GFP: C-terminális GFPfúziós humán tripszinogén 4 A izoforma, melyben a -44-es pozíciójú ATG tripletet delécióval eltávolították, és a +1-es pozícióban lévő CTG bázishármast ATG-re mutáltatták; p28 L del 125 T4-GFP: C-terminális GFP fúziós humán tripszinogén 4 A izoforma, melyben az első 125 bázist delécióval eltávolították, a +1-es pozícióban pedig CTG tripletet tartalmaz. Az ábra Németh és mtsi. kéziratában (2006) található ábra módosításával készült. Ezen konstrukciók által kódolt fúziós fehérjék fluoreszcencia intenzitás alapján becsült expresszió szintjének elemzése azt mutatta, hogy nagyobb mennyiségű fehérje termelődik, ha a B izoformában a CTG start-tripletet (p28 L T4-GFP) visszamutáltatják konvencionális start ATG bázishármasra (p28 M T4-GFP). A vad típusú A izoformát (p72 M T4-GFP) a sejtek nagyobb mennyiségben termelték, mint az ATG start-triplettel rendelkező B izoformát (p28 M T4-GFP). Készültek olyan konstrukciók is, melyekben különböző hosszúságú szakaszok a +1-es pozíciójú CTG triplet előtt lévő szekvenciából, mint 5 nem-transzlálódó régió (a 72 tagú peptid N-terminálisa, a start ATG bázishármast deletálva) előzték meg a CTG kódot (p28 L T4-GFP, p28 L del 125 T4- GFP). Ezen konstrukciókkal transzfektált sejteket vizsgálva megállapították, hogy a B izoforma szintézise akkor is megtörténik, ha a CTG kód előtt egy mindössze 7 bázisnyi szakaszt hagynak meg a vad típusú szekvenciából (p28 L del 125 T4-GFP), ám a fehérjeexpresszió szintje függ az 5 nem-transzlálódó régió hosszától. Ezek az 66

67 eredmények arra utalnak, hogy az alternatív transzláció iniciáció in vivo elindul a CUG kodontól, az így keletkező fehérje valóban leucin kezdő aminosavval rendelkezik, továbbá ez a nem-konvencionális mechanizmus szerepet játszhat a fehérje expresszió erősségének szabályozásában. 5.2 A humán tripszinogén 4 A, B, illetve rekc izoforma membránkötő képességének vizsgálata A humán tripszinogén 4 A és B izoformája szokatlan N-terminális peptiddel rendelkezik, mely karakterében eltér a szekretált fehérjék szignálpeptidjétől. Ezen peptidek potenciális szerepe lehet, hogy membránba horgonyozzák a zimogént, ezáltal járulva hozzá a fehérje sejten belüli transzportjához. Hogy megvizsgáljam, alkalmasak-e ezek a peptidek biológiai membránokkal való interakcióra, precipitációs kísérleteket végeztem a humán tripszinogén 4 mindhárom izoformájával. A fehérjéket egyensúlyba hoztam agyszövetből izolált membrán frakciókkal, majd ultracentrifugálást követően SDS poliakrilamid gélelektroforézis és Western blot segítségével vizsgáltam, hogy mely izoformák kötődtek a membránpreparátumokhoz (11. ábra). 67

68 11. ábra A humán tripszinogén 4 különböző izoformáinak membránkötő képessége. A rekombináns fehérjéket patkány agyszövetből izolált plazmamembrán (A), illetve mikroszóma (B) frakcióval inkubáltam. A kötődő és nem kötődő fehérjéket centrifugálással választottam szét, majd SDS poliakrilamid gélelektroforézist követően Western blottal mutattam ki. A molekulasúly marker (Prestained Protein Molecular Weight Marker, Fermentas) melletti számok az egyes standard fehérjék molekulasúlyát jelzik kilodaltonban megadva. A: 1. rekc izoforma k 2. rekc izoforma m, cs 3. rekc izoforma m, f 4. B izoforma k 5. B izoforma m, cs 6. B izoforma m, f 7. A izoforma k 8. A izoforma m, cs 9. A izoforma m, f 10. plazmamembrán frakció k, cs 11. plazmamembrán k, f. B: 1. rekc izoforma k, 2. rekc izoforma m, f 3. B izoforma k 4. B izoforma m, f 5. B izoforma m, 0,1 M NaCl-os mosás, f 6. B izoforma m, 1 M NaCl-os mosás, f 7. A izoforma k, 8. A izoforma m, f 9. A izoforma m, 0,1 M NaCl-os mosás, f, 10. A izoforma m, 1 M NaCl-os mosás, f k: kontroll, m: membrán frakcióval inkubált, f: felülúszó, cs: csapadék Eredményeim szerint a humán tripszinogén 4 rekc izoformája nem mutat affinitást agyszövetből izolált mikroszóma, illetve plazmamembrán frakció felé, tehát a szekréciós szignál peptid, illetve a proteáz domén nem elegendő ahhoz, hogy a fehérje biológiai membránokhoz kötődni tudjon. Ezzel szemben, a szokatlan N-terminális szekvenciával rendelkező A és B izoforma egyaránt képes kötődni ezekhez a membránokhoz. Ez a kölcsönhatás nem bontható meg nagy ionerejű oldattal való mosással (9.B ábra), tehát az interakcióban nemcsak ionos kölcsönhatások, hanem egyéb másodlagos kötőerők is fontosak. Ez az eredmény arra is utalhat, hogy a humán tripszinogén 4 nem egy transzmembrán fehérjéhez kötődve kapcsolódik a membránhoz, hanem direkt módon N-terminális peptidje segítségével beépül a membránba. A kölcsönhatás specificitásának bizonyítására leszorítási kísérleteket végeztem. A 68

69 rekombináns B izoformát az N-terminális peptidnek megfelelő, szilárd fázisú szintézissel előállított 28 tagú peptid a rekombináns fehérjéhez képest 10-szeres moláris feleslege jelenlétében inkubáltam a membránfrakcióval. A hozzáadott peptiddel részlegesen le tudtam szorítani a kötődő fehérjét (be nem mutatott adatok). Ezek az eredmények arra utalnak, hogy a humán tripszinogén 4 A és B izoformájának N-terminális peptidjei betölthetnek membránhorgonyzó funkciót. Ugyanakkor cirkuláris dikroizmus spektroszkópiai méréseim alapján sem a 28, sem a 72 tagú peptid nem tartalmaz helikális elemeket, amit transzmembrán peptidek esetén várhatnánk, bár trifluor ecetsav és SDS hozzáadásával indukálni lehetett ezen peptidekben helikális struktúra kialakulását (be nem mutatott adatok). Ezen előkísérletek alapján ezek az N-terminális peptidek szerepet játszhatnak abban, hogy a sejten belül membránok közelébe irányítsák a humán tripszinogén 4-et. Ez fontos lehet ahhoz, hogy a tripszinogén a diszulfid hidak kialakulását lehetővé tevő kémiai környezetbe kerülhessen a sejten belül. A humán tripszin 4 ugyanis tíz ciszteint tartalmaz, melyekből kialakuló öt diszulfid híd stabilizálja a fehérje szerkezetét. A diszulfid hidak csak oxidáló redoxpotenciálú közegben alakulhatnak ki. Szekretált fehérjék esetén ez az ER-ben történik meg. Ebben a kompartmentben a redoxpotenciál erősebben oxidáló jellegű, mint a citoszolban, és a glutation az egyik fő redox puffer komponens a szekréciós útvonalban (Hwang és mtsi. 1992). Amennyiben a fehérje nem kerül szekrécióra, a korrekt térszerkezetű tripszin csak a sejten belüli olyan régiókban alakulhat ki, ahol ezt a redoxpotenciál lehetővé teszi. Ilyen lehet sejtmembránok, pl. az ER közvetlen közelében a citoplazma is. Virális fehérjék esetén találtak már példát arra, hogy a fehérjében stabil diszulfidhidak tudnak kialakulni a citoplazmában, a folyamathoz kedvezőtlen redox környezet ellenére (Senkevich és mtsi. 2000). A citoplazmatikus fehérjékben szokatlan diszulfid híd található hipertermofil archeák egyes fehérjéiben is (Littlechild és mtsi. 2004), köztük egy cisztein proteázban is (Singleton és mtsi. 1999), sőt van példa eukarióta fehérje, egy chaperonin esetében is citoplazmában kialakuló diszulfid hídra (Pappenberger és mtsi. 2002). Mindazonáltal ezen különleges N-terminális peptideknek a szekréció, illetve az expresszió szabályozásában, a fehérje sejten belüli elhelyezkedésben in vivo játszott szerepe egyelőre tisztázatlan. 69

70 5.3 A humán tripszinogén 4 mrns mennyiségi mérése Real-time kvantitatív PCR-rel Real-time kvantitatív PCR reakció körülményeinek optimalizálása A munka folytatásaként meghatároztam a humán tripszinogén 4 mrns-ének relatív mennyiségét különböző agyi régiókban, neurológiailag normál egyénekből származó, rövid post mortem idejű mintákból. Előkísérletekben optimalizáltam a kvantitatív PCR reakció körülményeit. Kiválasztottam a humán tripszinogén 4 génjére tervezett három oligonukleotid-párból a leghatékonyabban amplifikáló párt (a Függelékben csak ennek a szekvenciáját tüntettem fel). Az alkalmazott primerpár a proteáz domén egy szakaszához anellál. Bár a specificitást legbiztosabban az N-terminális peptidre anelláló primer biztosítaná, 5 RACE PCR eredményeim azt mutatják, hogy e peptidnek megfelelő mrns hosszának varianciája nagy, így kevésbé alkalmas templátnak a mennyiségi meghatározáshoz. Meghatároztam a primerek optimális koncentrációját is a reakcióelegyben, ami 50 nm-nak bizonyult. Előkísérleteim szerint a kétlépcsős hőprofil (az anelláció és a lánchosszabbítás azonos hőmérsékleten, 60 C-on történik) alkalmasabb a mérésre, mint a háromlépcsős (az anelláció a lánchosszabbításhoz képest C-kal alacsonyabb hőmérsékleten történik). Kritikusnak bizonyult az amplikon hossza is: reprodukálható eredményeket a gyártó által ajánlott kb bázisnyi amplifikált DNS szakasz esetén kaptam. Előkísérleteim szintén rávilágítottak arra, hogy az ismert koncentrációjú templátot tartalmazó standard mintának nem alkalmas a plazmid DNS, hanem ismert mennyiségű RNS-ről szintetizált cdns-t kell alkalmazni. Plazmid DNS esetén a hígítási sor egyes tagjainak Ct értékei nem a koncentrációjuknak megfelelő sorrendben követték egymást. A Ct érték az a PCR ciklusszám, amely szükséges ahhoz, hogy egy adott templátmennyiséget tartalmazó reakcióelegy az amplifikáció során egy meghatározott fluoreszcenciaértéket elérjen. Valószínűleg cirkuláris kettősszálú DNS templát esetén az anelláció és a hődenaturáció eltérő módon megy végbe, illetve más az amplifikáció hatásfoka is, mint amikor a templát egyszálú lineáris DNS. Tapasztalataim szerint azonban a standard cdns-ek sem a várt Ct értékeket mutatták, ha a PCR reakcióban mindössze szorosra hígultak. Ennek oka lehet az, hogy a cdns szintézishez 70

71 használt puffer 10 mm DTT-t tartalmaz, ami ha nem hígul ki kellő mértékben a PCR reakcióban, zavarja a SYBR Green I festékkel való detektálást (Lekanne Deprez és mtsi. 2002). Ezért a mérésnél cdns mintákat a reakcióban általában 100-szoros hígításban alkalmaztam, ahol a DTT hatása már elhanyagolható. Ezenfelül be kellett állítanom az aktin és a tripszin standard sorok koncentrációtartományát is, hogy a mért minták beleessenek a kalibrálóegyenes által lefedett tartományba. Minden mérés során futtattam templát nélküli kontroll mintát is. Az optimalizálás során vizsgáltam a minták tárolhatóságát is. Azonos mintából izolált RNS-ről szintetizált cdns-t templátként használva elvégeztem a PCR reakciót a cdns szintézist követő napon, illetve 8 hét múlva. A 12. ábrán látható, hogy a későbbi mérésnél lényegesen, mintegy 6-szor kisebb humán tripszinogén mrns relatív mennyiséget tudtam mérni. Ez azt mutatja, hogy a humán tripszinogén cdns gyorsabban degradálódik, mint az aktin cdns, továbbá csak a cdns szintézist követően a lehető legrövidebb időn belül elvégzett PCR reakció ad releváns eredményt. A továbbiakban bemutatott méréseket ennek megfelelően végeztem el. Ugyanakkor az azonos mintából újból RNS-t preparálva, arról cdns-t szintetizálva és azt 24 órán belül megmérve nagyon hasonló eredményt kaptam. Ez mutatja az RNS izolálás, cdns szintézis és a kvantitatív PCR reprodukálhatóságát. 71

72 12. ábra A szintetizált cdns minták tárolhatósága, illetve a mérési módszer megbízhatósága egy példán bemutatva. A mérések ugyanabból az agymintából készített cdns-ről készültek. 1.: az RNS izolálást követően frissen szintetizáltam a cdns-t, majd 24 órán belül használtam templátként a PCR reakcióhoz. 2.: ugyanerről a cdns-ről 2 hónapos -80 C-on való tárolást követően készült mérés. 3.: ugyanebből az agymintából újbóli RNS izolálást, cdns szintézist és 24 órán belüli mérést követő eredmény A Ct értékek mrns mennyiségre való konvertálása és a kalibrálóegyenesek meghatározása A real-time PCR reakció során a normalizált riporter változást ( Rn) mérjük a ciklusszám függvényében. A 13. ábrán tipikus amplifikálási ábrázolások láthatók humán agyi mintákból izolált, illetve standard cdns templátokról. 72

73 13. ábra 1,4 x ,12 x 10-4 pikogramm mrns-ről szintetizált humán tripszinogén 4 mrns standard cdns minták (lila), egy kisagyi kéreg (narancssárga) és egy nyaki gerincvelő (zöld) minta amplifikálási ábrázolása, azaz a normalizált riporter fluoreszcencia intenzitás változás ábrázolva a PCR ciklusszám függvényében. A vízszintes vonal az exponenciális fázison belül önkényesen választott fluoreszcencia küszöbérték ( Rn = 0,2), az ehhez tartozó PCR ciklusszám az amplifikálási ciklus küszöbérték (Ct). A detektált Ct értékek a kalibrálóegyenes segítségével kiindulási templát mrns mennyiségre konvertálhatók. A Ct érték exponenciális fázison belül való önkényes megválasztása után az egyes mintákban a kiindulási templátkoncentráció a Ct értékből a kalibrálóegyenes egyenletének ismeretében visszaszámolható. A mintákból a humán tripszinogén 4 és a β-aktin mrns mennyiségét is megmértem. Mivel a β-aktin génje konstitutívan expresszálódik, belső kontrollként alkalmazható (Sturzenbaum és Kille 2001; Suzuki és mtsi. 2000). A β-aktin mrns mennyiségével való normálással korrigálni lehet a reakcióba bemért össz-rns (össz-cdns) mennyiségének varianciáját. 73

74 14. ábra Kalibrálóegyenesek a β-aktin (A) és a humán tripszinogén 4 (B) mrns mennyiségének meghatározásához. A standard sor egyes tagjai in vitro szintetizált, ismert mennyiségű β-aktin illetve humán tripszinogén 4 mrns templátról szintetizált cdns minták. Minden pont 3 párhuzamos mérés átlagát és hibáját reprezentálja. Ct: az a PCR ciklusszám, ami alatt a normalizált fluoreszcencia intenzitás változás ( Rn) eléri a küszöbértéket. A kalibrálóegyenesekhez a standard mintákat ismert mennyiségű in vitro szintetizált RNS-ről cdns-t szintetizálva állítottam elő, majd az így kapott cdns-ből készített hígítási sor egyes tagjait használtam templátként a PCR reakcióhoz. A Ct értékeket a kiindulási templátmennyiség logaritmusának függvényében ábrázolva megkapjuk a kalibrálóegyenest (14. ábra). Az ábrán jól látható, hogy a standard minták által lefedett koncentrációtartományban a mért jel (Ct érték) egyenesen arányos a 74

75 kiindulási templátmennyiség logaritmusával, tehát az amplifikáció hatásfoka állandó a tartományon belül. A kalibrálóegyenes meredekségéből kiszámolható a PCR amplifikáció hatásfoka az alábbi egyenlet segítségével (Lekanne Deprez és mtsi. 2002): = (10 ) 1 1/ a A 10. egyenlet ahol A az amplifikálás hatékonysága, a pedig a kalibrálóegyenes meredeksége, ami elvileg nem lehet nagyobb -3,3-nél, mert ekkor a PCR amplifikálás hatásfoka nagyobb lenne, mint 100%. Az aktin kalibrálóegyenesek esetén az amplifikálás hatásfoka átlagosan 97,1 ± 2,9 % volt, míg a humán tripszinogén 4 kalibrálóegyenesekből számolt hatékonyság 87,4 ± 8,5%. Ez azt mutatja, hogy az amplifikálási hatékonyság függ a templát-primer pártól A real-time PCR reakciók specificitása A PCR reakciók specificitását az olvadási görbe analízisével erősítettem meg. A PCR reakció utolsó ciklusát követően a mintákat felfűtöttem 60 C-ról 92 C-ra 0,1 C/másodperc fűtési sebességgel a SYBR Green I festék fluoreszcencia intenzitásának folyamatos detektálása mellett. Az intenzitás hirtelen csökkenése az amplifikált DNS két szálának szétválását jelzi. A fluoreszcencia intenzitás hőmérséklet szerinti első negatív deriváltját ábrázolva a hőmérséklet függvényében megkapjuk a PCR termék olvadási görbéjét, melynek csúcsa megadja az olvadási hőmérsékletet. Mindkét oligonukleotid-pár esetén a görbék egyetlen olvadási hőmérséklettel voltak jellemezhetők (15. ábra), tehát az amplifikálás során csak egyféle hosszúságú és szekvenciájú, azaz homogén PCR termék keletkezett. A görbe alatti terület arányos a PCR termék mennyiségével, ami közel azonos az aktinspecifikus primerek esetében, míg a humán tripszinogén 4-specifikus oligonukleotidokkal végzett reakciónál nagy varianciát mutat. A humán tripszinogén 4 specifikus primerpár estén néhány random módon kiválasztott PCR terméket klónoztam és megszekvenáltam. Mindegyik klón szekvenciája megfelelt a humán tripszinogén 4 szekvenciájának, ami igazolja a reakció specificitását. 75

76 15. ábra A humán tripszinogén 4 (narancssárga) és β-aktin (lila) specifikus primerekkel amplifikált PRC termékek olvadási görbéje. Mindkét PCR termék esetén az olvadási görbe egyetlen olvadási hőmérséklettel jellemezhető, ami bizonyítja a termékek homogenitását. A humán tripszin 4 esetén az olvadási hőmérséklet 82,0 C, a β-aktin esetén pedig 84,2 C. Egyik reakcióban sem keletkezik primer dimer, amelynek olvadási hőmérséklete jóval alacsonyabb, kb. 75 C lenne A humán tripszinogén 4 mrns relatív mennyiségének eloszlása az agyban A méréseket agyterületenként három párhuzamos mintából is elvégeztem. Tapasztalataim szerint a mérési adatok az egyazon agyterülethez tartozó egyedi mintákból, bár bizonyos esetekben nagyon hasonlóak (pl. kisagy kéreg), más esetekben jelentősen eltérnek egymástól (pl. amygdala, kisagyi fehérállomány, nyaki gerincvelő, kérgi fehérállomány, hippocampus, nyúltvelő, parahippocampalis kéreg, plexus choroideus, temporalis cortex), akár tízszeres különbség is lehet a humán tripszinogén 4 mrns relatív mennyiségében (16. ábra). Ez arra utal, hogy az agyterület milyenségén kívül számos egyéb faktor is meghatározza az RNS-ek mennyiségét, amelyekre nézve egyes minták jelentősen eltérhetnek. Az agymintákról rendelkezésemre álló háttérinformációk alapján is elemeztem az adatokat. Az elemzés azt mutatta, hogy a humán tripszinogén 4 mrns relatív mennyisége nem függ a post mortem időtől, a minta kivételétől eltelt tárolási időtől, sem az egyén korától. A párhuzamos minták közti jelentős eltéréseket tehát valamely egyéb tényező vagy tényezők okozhatják, mint például az egyén fiziológiás vagy patológiás állapota. 76

77 16. ábra A humán tripszinogén 4 mrns relatív mennyiségének összehasonlítása azonos agyterületekből származó párhuzamos mintákban. Az amygdala minták esetén a különbség tizennégyszeres, míg a kisagy kéreg egyedi mintái közt csak másfélszeres különbség van. Az eltérés oka lehet a minták eltérő egyénből való származása, az egyének eltérő fiziológiás vagy patológiás állapota, illetve számos egyéb faktor. Az azonos agyterületekből származó párhuzamos minták adatait átlagolva a 17. ábrán bemutatott eloszlási képet kaptam. A humán tripszinogén 4 mrns relatív mennyisége a vizsgált agyterületekben a β-aktin mrns mennyiségéhez viszonyítva 3-7,4%. A legnagyobb különbség a kérgi fehérállomány és a kisagy kéreg minták között figyelhető meg, itt az eltérés 24-szeres. Az adatokat variancia analízissel elemeztem az Origin v7.5 software segítségével. A nullhipotézis az volt, hogy az egyes agyterületekben mért relatív mennyiségek átlagai azonosak, míg az alternatív hipotézis szerint egy vagy több agyterületben a mért relatív arány átlaga eltér a többi terület átlagától. 0,01-os szignifikancia szint mellett az egyes agyterületekben a humán tripszinogén 4 mrns relatív mennyisége szignifikánsan eltérő. Megfigyelhető továbbá, hogy az evolúciósan ősibb agyterületeken, például a bulbus olfactoriusban, nyaki gerincvelőben, nyúltvelőben a humán tripszinogén 4 mrns-ének relatív mennyisége alacsonyabb, mint a filogenetikai szempontból fiatalabb agyi régiókban, mint például a kisagy kéregben, occipitalis cortexben (17. ábra). Ez utalhat arra, hogy a humán tripszin 4 funkciója inkább az evolúciósan újabb agyterületekkel asszociált. Meg kell jegyeznünk azonban, hogy a központi idegrendszerben betöltött funkció szempontjából a fehérje mennyisége a releváns, amiről az mrns mennyisége nem feltétlenül ad információt. 77

78 17. ábra A humán tripszinogén 4 mrns-ének β-aktinhoz viszonyított mennyisége különböző agyterületekben. Az evolúciósan ősibb agyi régiókban kisebb a humán tripszinogén 4 mrns relatív mennyisége, mint az evolúciósan újabb területekben. 78

79 5.4 A vad típusú és az R193G mutáns humán tripszin 4 és a 4-metilumbelliferil 4-guanidinobenzoát szubsztrát analóg reakciójának kinetikai és termodinamikai elemzése Doktori munkám ezen részének célja az volt, hogy azonosítsam azokat az enzimatikus lépéseket, amelyeket befolyásol a Gly193Arg mutáció a humán tripszin 4-ben, továbbá célunk volt a vad típusú és az R193G mutáns humán tripszin 4 szubsztrát hidrolízise közti termodinamikai különbségek vizsgálata is. Ebből a célból expresszáltam a vad típusú, illetve az R193G mutáns humán tripszin 4-et és tanulmányoztam a reakciójukat 4-metilumbelliferil 4-guanidinobenzoát (MUGB) fluorogén szubsztrát analógon stopped flow készüléket használva. A választott szubsztrát analóg azért alkalmas a méréshez, mert a dezacilezés a MUGB esetén lassabb, mint az acilezés, és az egyedi sebességi állandók egyértelmű meghatározásának feltétele, hogy az utolsó reakciólépés legyen a sebesség-meghatározó Az időgörbék lefutása A 18. ábrán tipikus stopped flow mérési görbék láthatók a vad típusú és az R193G mutáns humán tripszin 4 MUGB-bal való reakciójáról pszeudo-elsőrendű reakciókörülmények között (Tóth és mtsi. 2006a). A reakciók során a fluoreszcencia változás időgörbéje egy burst fázist követő lineáris fázissal jellemezhető mindkét enzim esetén. 79

80 80

81 18. ábra Stopped flow mérések a vad típusú (A) és az R193G mutáns (B) humán tripszin 4 4-metilumbelliferil 4-guanidinobenzoát észter szubsztráttal való reakciójáról 36 és 12 C-on. 0,1 µm vad típusú és R193G mutáns humán tripszin 4-et gyorskeveréssel reagáltattam 60 µm, illetve 200 µm szubsztráttal, és 365 nm-es gerjesztés mellett követtem a fluoreszcencia emissziót egy 420 nm-es vágószűrőn keresztül. Az itt bemutatott adatokat logaritmikus időskálán vettem fel. Az analizált görbék 4-7 időgörbe átlagai. Az időgörbéket kettős exponenciális függvénnyel lehet leírni (folyamatos vonal), melyet egy lineáris fázis követ. A lineáris fázis (steady state) meredekségét másodperces mérésekből határoztam meg (pl. C), és levontam a tranziensekből a kétfázisú burst jobb láthatóvá tételéhez. (F(t) = A gyors e -k obs gyors t + A lassú e -k obs lassú t + F ), ahol F(t) a fluoreszcencia a t időpontban, A az amplitúdó, k a megfigyelt sebességi állandó (observed rate constant) és F a végső fluoreszcencia intenzitás. A mérési adatokra illesztett egy exponenciálisokat (szaggatott vonal) is bemutatom, hogy kiemeljem a tranziensek jellegének eltérését egy egyfázisú burst-től. C: Lineáris időskálájú mérések 0,1 µm vad típusú ( ) illetve R193G mutáns ( ) humán tripszin 4 és 15 µm 4-metilumbelliferil 4-guanidinobenzoát szubsztrát analóg reakciójáról. A méréseket 20 mm Tricin, ph 8,0, 10 mm CaCl 2 összetételű pufferben végeztem 20 C-on. A burst fázis egy kettős exponenciálissal írható le, melyhez egy gyors és egy lassú megfigyelt sebességi állandó (observed rate constant, k obs ) rendelhető. Ezen sebességi állandók függése a szubsztrátkoncentrációktól hiperbolikus (19. ábra), ami arra utal, hogy a reverzibilis szubsztrátkötési lépést legalább egy további lépés követi. A fluoreszcens jel ezen további lépések, azaz a kémiai reakció során keletkezik. A burst kétfázisú jellege két különböző, kinetikailag szétválasztható eseményre utal a MUGB hidrolízise során, és azt is mutatja, hogy ezek közül az első egy reverzibilis lépés. Végül, a burstöt követő lineáris szakaszt a dezacilezés következtében felszabaduló regenerált enzim keletkezése eredményezi. 81

82 5.4.2 A megfigyelt sebességi állandók szubsztrátkoncentráció-függése 19. ábra A kettős exponenciális függvények illesztéséből származó sebességi adatok a vad típusú (A), illetve az R193G mutáns (B) humán tripszin 4 MUGB szubsztráttal való reakciójáról, a szubsztrátkoncentráció függvényében ábrázolva. Az időgörbéket egy kétfázisú burstöt követő lineáris fázis jellemzi. A reakcióprofilokat kettős exponenciális függvények illesztésével elemeztem. Az ábrán a burst gyors ( ) és lassú fázisához ( ) rendelhető megfigyelt sebességi állandók láthatók a vad típusú (A) és az R193G mutáns (B) humán tripszin 4 esetén. A megfigyelt sebességi állandók hiperbolikusan függtek a szubsztrátkoncentrációtól. Az elemi sebességi állandókat az illesztett hiperbolák paramétereiből számoltuk. A megfigyelt sebességi állandók hiperbolikusan függtek a szubsztrátkoncentrációtól. A megfigyelt sebességi állandókat a szubsztrátkoncentráció 82

83 függvényében ábrázolva eltérő profilt eredményezett a két enzim esetében (19. ábra). A gyors fázis 148 µm MUGB-nál érte el a fél-telítést és maximális sebessége 9,95 ± 0,4 s -1 a vad típusú enzim esetében, és 23,9 ± 1,4 s -1 -os értéket ért el 58 µm-os féltelítéssel az R193G mutáns enzim esetén 20 C-on. A gyors fázis megfigyelt sebességi állandóját ábrázolva a szubsztrátkoncentráció függvényében, majd ennek kezdeti szakaszára egy egyenest illesztve annak tengelymetszete 0,23 ± 0,04 s -1, meredeksége pedig 0,068 ± 0,0004 µm -1 s -1 a vad típusú enzim esetén, míg ezek értéke 0,042 ± 0,006 s -1 és 0,38 ± 0,019 µm -1 s -1 az R193G mutáns esetében. A lassú fázist jelentősen alacsonyabb szubsztrátkoncentrációnál lehetett telíteni, és maximális sebessége 0,42 ± 0,03 s -1 volt a vad típusú enzimnél és 1,44 ± 0,27 s -1 a 193-as pozícióban glicinnel rendelkező enzimvariánsnál. A gyors fázis amplitúdója növekvő hiperbolikus, míg a lassú fázisé csökkenő hiperbolikus függést mutatott a szubsztrátkoncentrációtól a vad típusú humán tripszin 4 esetében. Ezzel szemben az R193G mutánsnál a gyors és a lassú fázis amplitúdója állandó volt a vizsgált szubsztrátkoncentráció tartományban. Mindazonáltal, telítési szubsztrátkoncentrációknál a gyors fázis a domináns mindkét enzim esetében: a gyors fázis relatív amplitúdója 20 C-on a teljes amplitúdó (jelváltozás) 95%-át teszi ki a vad típusú enzim esetében és a 85%-át az R193G mutáns esetén A reakció leírására felállított modell és annak validálása A burst kétfázisú jellege és a megfigyelt sebességi állandók szubsztrátkoncentrációtól való hiperbolikus függése alapján a következő négylépéses sematikus modellt feltételeztük a reakció jellemzésére: 1. modell melyben E a szabad enzimet, S a szubsztrátot (MUGB) jelöli, C a kovalens enzimszubsztrát komplex, P1 és P2 az első (4-metilumbelliferon) és a második (guanidinobenzoát) terméket jelenti. A fluoreszcens jelet adó specieseket csillaggal jelöltem meg. 83

84 A feltételezett mechanizmus igazolására megvizsgáltam, hogy a fluoreszcens jel a szubsztrát kötése közben, vagy az ezt követő reakciólépések során keletkezik. Ezen kísérletekhez az S195A mutáns humán tripszin 4-et használtam, amely képes a MUGB megkötésére, de nem katalizálja az acilezést. A MUGB és a katalitikusan inaktív enzimvariáns gyors összekeverésekor nem tudtunk fluoreszcencia változást detektálni. Ez arra utal, hogy a fluoreszcens jel túlnyomó része nem a kötési lépéskor keletkezik. Az időgörbék kezdeti szakaszán egy lag fázis megjelenése volt várható, mivel azt a lépést, amely során a fluoreszcens jel keletkezik, megelőzi egy másik lépés, a szubsztrát megkötése. Azonban a tranziensekben nem volt detektálható a lag fázis. A teljes fluoreszcens szignál 5%-ának megjelenése a MUGB-nak az enzim aktív helyéhez való kötésére egy lehetséges magyarázat a lag fázis hiányára. Ezt a feltételezést megerősítettük a reakció modellezésével a Berkeley Madonna v szoftver (www.berkeleymadonna.com) segítségével, ami azt mutatta, hogy a kötési lépés során megjelenő kismértékű fluoreszcencia intenzitás növekedés képes kompenzálni a lag fázist, ami ezáltal detektálhatatlanná válik. Azt is feltételeztük, hogy a 4-metilumbelliferon fluoreszcencia intenzitása nem változik jelentősen az enzim felszínéről való disszociáció hatására. A detektált jel kettős exponenciálissal írható le, ha a reakció során a jelváltozás kialakulása megoszlik két populáció között (E S C* E-P2 + P1**, ahol a csillag a fluoreszkáló specieseket jelzi, a csillagok száma pedig a fluoreszcencia intenzitására utal, tehát a séma második lépésében is történik jelváltozás). Azonban kettős exponenciálist kapunk akkor is, ha a jel kialakulása ugyan nem oszlik meg két populáció között, viszont a jel egy gyors előegyensúllyal keletkezik, amit egy lassabb irreverzibilis lépés követ (k 3 ) (E S C* E-P2 + P1*). Ekkor az egyensúly, amivel a jel keletkezik, gyorsan beáll, ez adja a gyors fázis amplitúdóját. Mivel azonban az egyensúlyt követi egy irreverzibilis lépés, ez elszívja az előegyensúlyban keletkezett C* populációt, ezáltal újra keletkezhet a jelet még nem szolgáltató E S készletből jeladó populáció, amelynek populáltságát az előegyensúlynak a termék visszaalakulása irányába mutató sebességi állandója (k -2 ) határozza meg. Ez adja a lassú fázis amplitúdóját. A jelkeletkezés ezen mechanizmusát támasztja alá az is, hogy a szubsztrátkoncentráció növelésével a jel kialakulását megelőző reverzibilis lépés egyre irreverzibilisebbé válik, ezért a gyors fázis relatív amplitúdója (amplitúdó gyors/(amplitúdó gyors + amplitúdó lassú ) nő. A gyors és a lassú fázis amplitúdójának 84

85 arányát tehát a kovalens enzim-szubsztrát komplex képződésének egyensúlyi állandója (K 2 ) határozza meg (K 2 = amplitúdó gyors fázis /amplitúdó lassú fázis ) Az elemi reakciólépések sebességi állandóinak származtatása A gyors és a lassú fázis amplitúdójának arányát tehát a kovalens enzimszubsztrát komplex képződésének egyensúlyi állandója (K 2 ) határozza meg (K 2 = amplitúdó gyors fázis /amplitúdó lassú fázis ). Mivel a második reakciólépés egy elsőrendű reverzibilis reakció, melyek esetében a megfigyelt sebességi állandó a termékképződés és a termék visszaalakulása irányába mutató sebességi állandó (forward és reverse rate constant) összegével egyenlő (k obs = k forward + k reverse ), a gyors fázis megfigyelt sebességi állandója egyenlő lesz a második reakciólépés termékképződés irányába és a termék visszaalakulása irányába mutató sebességi állandójának összegével (k obs gyors fázis = k 2 + k -2 ). Ebből a k 2 -t behelyettesítve K 2 k -2 -vel és a kifejezést átrendezve kapjuk a következő összefüggést: k obs gyors fázis = k 2 (K 2 + 1)/K 2. A szubsztrátkötési lépés egyensúlyi állandója (K d = k -1 /k 1 ) a gyors fázis megfigyelt sebességi állandó-szubsztrátkoncentráció függvény meredekségéből származtatható (k obs gyors fázis kezdeti meredekség = k 2 /K d ). Mivel a harmadik reakciólépést egy előegyensúly előzi meg, ez befolyásolja a reakciólépés sebességét. A lassú fázis megfigyelt sebességi állandója a második reakciólépés egyensúlyi állandójából (K 2 ) és a harmadik lépés sebességi állandójából számolható (k obs lassú fázis = k 3 K 2 /(K 2 + 1). Könnyen belátható, hogy miért kell a sebességi állandók egyszerű összegzése (k obs lassú fázis = k 3 + k -3 ) helyett a lépést megelőző előegyensúly egyensúlyi állandójával is számolnunk. Abban az esetben, ha k 2 >> k -2, azaz az előegyensúly erősen el van tolva a termékkeletkezés irányába, a K 2 /(K 2 + 1) hányados 1-hez tart, tehát nem limitálja a harmadik reakciólépés megfigyelt sebességi állandóját. Ezzel szemben, ha k 2 << k -2, a K 2 /(K 2 + 1) hányados értéke egynél kisebb lesz, összhangban azzal, hogy az előegyensúly limitálja a harmadik lépés sebességét. A k -3 -at elhanyagoljuk a számolás során, mivel a termék (E-P2) mennyisége a szubsztrátéhoz képest elhanyagolhatóan kicsi, illetve az első termék (P1) disszociál az enzimről, tehát a harmadik reakciólépés irreverzibilis. A második reakciólépés esetén a K 1 /(K 1 + 1) hányados értéke egyhez tart, mivel a második reakciólépést megelőző esemény a MUGB megkötése, ami erősen el van tolva a termékképződés irányába. 85

86 Ezért a második reakciólépés megfigyelt sebességi állandójának (k obs 2 ) számolásakor az előegyensúly korrigáló hányadosa kiesik. Végezetül, a burstöt követő lineáris fázis a steady state-nek felel meg. A burst nagysága egyenlő a gyors és a lassú fázis amplitúdójának összegével. Továbbá, ha a termék enzimhez való visszakötődése elhanyagolható, és ha a termékfelszabadulás legalább egy nagyságrenddel lassabb, mint az ezt megelőző lépések sebessége, egy enzimatikus ciklus alatt ugyanannyi termék keletkezik, mint amennyi enzim volt a reakcióban, tehát a burst nagysága egyenlő a bemérési enzimkoncentrációval. A dezacilezés sebessége a fluoreszcencia változása az időben a lineáris fázisban, azaz a lineáris fázis meredeksége. A dezacilezés sebességi állandóját a sebességet a guanidinobenzoil tripszin koncentrációjával elosztva kapjuk meg, ami nagy szubsztrátfelesleg esetén egyenlő a bemérési enzimkoncentrációval. Mivel a bemérési enzimkoncentráció a két fázis amplitúdójának összegével azonos, a dezacilezés sebességi állandóját a k 4 = steady state meredeksége/(amplitúdó gyors fázis + amplitúdó lassú fázis) összefüggésből számolhatjuk. Az elemi sebességi állandókat a fentiekben levezetett és az I. táblázatban bemutatott egyenletekkel számoltam, és a II. táblázatban foglalom össze. K 2 = amplitúdó gyors fázis /amplitúdó lassú fázis k 2 = K 2 k obs gyors /(K 2 + 1) k -2 = k obs gyors - k 2 = k 2 /K 2 k 3 = k obs lassú (K 2 + 1)/K 2 k 4 = steady state meredeksége/(amplitúdó gyors + amplitúdó lassú ) 11. egyenlet 12. egyenlet 13. egyenlet 14. egyenlet 15. egyenlet I. táblázat Az elemi sebességi állandók és a második reakciólépés egyensúlyi állandójának számolására használt egyenlet 86

87 5.4.5 A vad típusú és az R193G mutáns humán tripszin 4 katalitikus ciklusának összehasonlítása Doktori munkám ezen részében a humán tripszin 4-ben az R193G szubsztitúció hatását tanulmányoztam a katalízis folyamatára 4-metilumbelliferil 4-guanidinobenzoát szubsztráton. Tranziens kinetikai módszerrel azt vizsgáltam, hogy melyik reakciólépést, illetve reakció állapotot befolyásolja ez a mutáció. A szubsztráttelítési kísérletekből származó adatokat a II. táblázatban mutatom be. htry4 WT htry4 R193G k 2 (s -1 ) 9,19 ± 0,01 20,22 ± 1,4 k -2 (s -1 ) 0,81 ± 0,05 3,56 ± 0,006 k 3 (s -1 ) 0,46 ± 0,02 1,70 ± 0,3 k 4 (s -1 ) (1,85 ± 0,51) 10-3 (3,28 ± 3,1) 10-4 K 2 11,4 ± 0,7 5,68 ± 0,4 II. táblázat A vad típusú, illetve az R193G mutáns humán tripszin 4 és a 4-metilumbelliferil 4-guanidinobenzoát szubsztrát reakcióját leíró elemi sebességi állandók (k 2, k -2, k 3, k 4 ) és a második reakciólépés egyensúlyi állandója (K 2 ) 20 C-on. 0,1 µm enzimet reagáltattam gyorskeveréssel stopped flow készülékben növekvő koncentrációjú szubsztráttal a telítés eléréséig. A fluoreszcencia intenzitás változását követtem 365 nm-es gerjesztés mellett az emissziót egy 420 nm-es vágószűrőn keresztül detektálva. A tranziensekre kettős exponenciálist követő lineáris függvényt illesztettem. Az elemi sebességi állandókat az I. táblázatban összefoglalt egyenlettel számoltam. Az értékek 3 illetve 2 független adatsor átlagai és standard hibái a vad típusú és az R193G mutáns enzim esetében, és minden elemzett mérési görbe 5-7 felvett időgörbe átlaga. Az egyensúlyi disszociációs állandó a két enzim esetében 2-3-szoros különbséget mutat (K d htry4wt = 136 ± 1 µm, K d htry4r193g = 53,6 ± 6,6 µm) ami arra utal, hogy energetikailag az R193G mutációnak nincs jelentős hatása a MUGB kötésének erősségére (293 K-en G kötési htry4wt = -11,9 kjmol -1, G kötési htry4r193g = -9,7 kjmol -1 ). A kovalens enzim-szubsztrát komplex képződése mindkét enzim esetében reverzibilisnek bizonyult. Ezen reakciólépés termékképződés irányába mutató sebességi állandója kétszer kisebb a vad típusú enzim esetén (k 2 htry4wt = 9,19 ± 0,01 s -1, k 2 htry4r193g = 20,2 ± 1,4 s -1 ) a termék visszaalakulása irányába mutató sebességi állandója pedig 4-szer kisebb (k -2 htry4wt = 0,81 ± 0,05 s -1, k -2 htry4r193g = 3,56 ± 0,006 s -1 ), ezért a második reakciólépés egyensúlya erősebben el van tolva a termékképződés irányába a 87

88 vad típusú enzim esetében (K 2 htry4wt = 11,4 ± 0,7, K 2 htry4r193g = 5,7 ± 0,4). A következő esemény 3-4-szer lassabb a vad típusú enzimben (k 3 htry4wt = 0,46 ± 0,02 s -1, k 3 htry4r193g = 1,70 ± 0,29 s -1 ). Mindkét enzim esetén a szubsztrátnak turnovere van, tehát a termék disszociál az enzim felszínéről. A vad típusú enzim általi dezacilezés kissé (5-6-szor) gyorsabb, mint az R193G mutáns esetében (k 4 htry4wt = (1,85 ± 0,51) 10-3 s -1, k 4 htry4r193g = (3,28 ± 3,06 ) 10-4 s -1 ) A második és harmadik reakciólépés termodinamikai paraméterei A szubsztráthidrolízis termodinamikájának vizsgálata céljából a 6-36 ºC-os hőmérsékleti tartományban követtem a vad típusú, illetve az R193G mutáns humán tripszin 4 és a MUGB reakcióját. A sebességi állandók és a második reakciólépés egyensúlyi állandójának (K 2 ) hőmérsékletfüggését a linearizált Eyring illetve van t Hoff ábrázolásokkal elemeztem (III. táblázat, 20. és 21. ábra). 88

89 20. ábra A második reakciólépés termékképződés irányába mutató (k 2 ) ( ) és a termék visszaalakulása irányába mutató sebességi állandójának (k -2 ) ( ) Eyring ábrázolása a vad típusú (A) és az R193G (B) mutáns humán tripszin 4 esetében. 0,1 µm enzim reakcióját vizsgáltam telítési koncentrációjú 4-metilumbelliferil 4-guanidinobenzoát szubsztráttal 3 C-onként a 6-36 C-os hőmérsékleti tartományban. A reakciókat 20 mm Tricin, ph 8,0 ± 0,1, 10 mm CaCl 2 pufferben végeztem. Az elemi sebességi állandókat a egyenletek segítségével számoltam, majd az ln (k/t) értékeket ábrázoltam az 1000/T függvényében. Az aktiválási paramétereket az adatokra illesztett lineáris függvények meredekségéből és tengelymetszetéből számoltam az 1. és 2. egyenlet alapján. 89

90 21. ábra A második reakciólépés egyensúlyi állandójának (K 2 ) van t Hoff ábrázolása a vad típusú ( ) és az R193G mutáns ( ) humán tripszin 4 esetében. A reakciósebességek hőmérsékletfüggését 0,1 µm enzim telítési koncentrációjú MUGB szubsztráttal való reakcióján vizsgáltam 3 C-onként a 6-36 Cos hőmérsékleti tartományban. A reakciókat 20 mm Tricin, ph 8,0 ± 0,1, 10 mm CaCl 2 pufferben végeztem. Az elemi sebességi állandókat és egyensúlyi állandókat a egyenlet alapján számoltam, majd az ln K 2 értékeket ábrázoltam az 1000/T függvényében. A termodinamikai paramétereket az adatokra illesztett lineáris függvények meredekségéből és tengelymetszetéből számoltam a 3. és 4. egyenlet segítségével. A standard szabadentalpia ( Hº), entrópia ( Sº) és standard szabadenergia ( Gº) változás értékeket a van t Hoff ábrázolás meredekségéből illetve tengelymetszetéből származtattam, mivel a K 2 -t közvetlenül meghatározza a gyors és a lassú fázis amplitúdójának aránya, míg a k -2 a K 2 -ből származtatott paraméter (I. táblázat). A második, reverzibilis reakciólépés standard szabadenergia változása ( Gº) 293 K-en negatív mindkét enzimre nézve. Meg kell jegyezni azonban, hogy a van t Hoff ábrázolások lefutása feltűnően különböző a két enzim esetében. Ez a reakciólépés a vad típusú humán tripszin 4-ben erősen exoterm ( H htry4wt = -74,1 kjmol -1 ), és nagy standard entrópia csökkenés kíséri ( S htry4wt = -0,23 kjmol -1 K -1 ) ami biztosítja ezen reakciólépés reverzibilitását 293 K-en. Ezzel szemben, az R193G mutánsban a második reakciólépés endoterm ( H htry4r193g = 22,1 kjmol -1 ) és entrópia-hajtott ( S htry4r193g = 0,09 kjmol -1 K -1 ). Összehasonlítva a második reakciólépés aktiválási paramétereit, feltűnő különbséget találunk a két enzim között (III. táblázat). A termék visszaalakulása irányába mutató reakciólépés (k -2 ) Eyring ábrázolásának meredeksége és tengelymetszete a vad típusú enzim esetében nagymértékben eltér a mutáns enzimétől. Ennek megfelelően, az aktiválási szabadentalpia értékei H -2 htry4r193g = 90

91 55,0 kjmol -1 és H -2 htry4wt = 165 kjmol -1, az aktiválási entrópia értékei S 2 htry4r193g = -0,05 kjmol -1 K -1 és S 2 htry4wt = 0,32 kjmol -1 K -1 a két enzim esetén. A harmadik reakciólépés (k 3 ) kissé lassabb a vad típusú enzimben, mint az R193G mutánsban, amelyet a termodinamikai paraméterek között talált csekély különbségek tükröznek (III. táblázat). htry4 WT htry4 R193G k 2 a k -2 a K 2 b k 3 a k 2 a k -2 a K 2 b k 3 a meredekség -10,9 ± 0,5-19,9 ± 1,4 8,9 ± 1,6-7,1 ± 1,1-9,3 ± 0,6-6,6 ± 0,7-2,7 ± 0,3-2,6 ± 1,3 tengelymetszet 33,6 ± 1,8 61,8 ± 4,6-28,1 ± 5,4 18,3 ± 3,9 28,5 ± 2,2 18,1 ± 2,3 10,3 ± 0,9 3,7 ± 4,4 H (kjmol -1 ) S (kjmol -1 K -1 ) G (kjmol -1 ) H (kjmol -1 ) S (kjmol -1 K -1 ) G (kjmol -1 ) 91, ,9 77,1 55,0-21,6 0,08 0, ,05 0,04-0, ,17 67,0 72,5-72,1 65,7 68,8-70, , , , , , ,1 - III. táblázat A vad típusú, illetve az R193G mutáns humán tripszin 4 és a 4-metilumbelliferil 4-guanidinobenzoát reakciójának aktiválási és termodinamikai paraméterei. Az aktiválási és termodinamikai paramétereket az 1-4. egyenlet alapján számoltam. A meredekségek és tengelymetszetek értékei az illesztett lineáris függvények átlagait és standard hibáit reprezentálják. A H, H, G és G értékek 293 K-re vonatkoznak. a ezen paraméterek értékei az Eyring ábrázolásból származnak b ezen paraméterek értékei a van t Hoff ábrázolásból származnak 91

92 5.4.7 A vad típusú és R193G mutáns humán tripszin 4 MUGB szubsztráton mért kinetikai és termodinamikai paramétereinek értelmezése Az egyedi reakciólépések szeparálását lehetővé tevő szerkezeti okok Doktori dolgozatom ezen részében a humán tripszin 4-ben az R193G mutáció hatását vizsgáltam gyorskinetikai módszerekkel 4-metilumbelliferil 4-guanidinobenzoát fluorogén szubsztrátot használva. Egy korábbi tanulmányban leírták a guanidinobezoil-tripszin térszerkezetét, amely az acil-enzim intermediernek felel meg (Mangel és mtsi. 1990). E munka betekintést enged a lassú dezacilezés szerkezeti alapjaiba. A guanidinobenzoil-tripszin szerkezete néhány régióban feltűnően eltér a natív enzim szerkezetétől, és az észterkötés karbonil szénatomja körüli geometria szintén torzult. Ennek következményeként az enzim aktív helyénél elhelyezkedő rendezett hidrolítikus vízmolekulák nincsenek elég közel a hasadó észterkötéshez ahhoz, hogy nukleofil támadást indítsanak. Az a tény, hogy a reakciómechanizmus utolsó lépése, azaz a dezacilezés a sebesség-meghatározó lépés, illetve egy tranziens kinetikai technika alkalmazása együttesen tette lehetővé, hogy az egyes elemi reakciólépéseket megbízhatóan szeparálhassam és meghatározhassam sebességi állandójukat A tranziens kinetikai adatok alapján felállított finomított modell A szubsztráttelítési adatok alapján egy finomított modellt javaslunk a humán tripszin 4 illetve ennek R193G mutánsa és a MUGB szubsztrát reakciójának leírására. Korábbi tanulmányokban (Payne és mtsi. 1996; Urano és mtsi. 1988) különböző szerin proteázok MUGB-al való reakcióját steady state kinetikával vizsgálták, és a mechanizmust egy reverzibilis szubsztrátkötési lépésből, és az azt követő két irreverzibilis lépésből, az acilezésből és a dezacilezésből építették fel. A tranziens kinetikai módszerek alkalmazása lehetővé tette a folyamat részletesebb kinetikai elemzését, és feltárta, hogy a burst kétfázisú. Ezt a jelenséget már megfigyelték szarvasmarha tripszin és humán trombin esetében 4-nitrofenil 4-guanidinobenzoát szubsztrát analógon (Ryan és mtsi. 1976; Vajda és Náray-Szabó 1988), melynek más ugyan a távozó csoportja, de az acilező rész azonos a MUGB-éval, ám a jelenséget nem 92

93 vizsgálták részleteiben. A kétfázisú burst egy a szubsztrátkötést követő reverzibilis és egy irreverzibilis lépés elkülöníthetőségére utal a mechanizmusban. Annak alapján, hogy a MUGB kötése az S195A mutánshoz nem okozott fluoreszcencia intenzitás növekedést, és ismerve, hogy az első felszabaduló termék (4-metilumbelliferon) fluoreszcens, ezen két lépést a kötési lépés és a dezacilezés közötti eseményekhez kell kötnünk. Következésképpen két lehetséges magyarázatot kell megfontolnunk ezekre a kinetikailag szeparálható lépésekre: (i) a második, reverzibilis lépés a reakciómechanizmusban az acilezés, és a harmadik, irreverzibilis lépés a 4-metilumbelliferonnak az enzim felszínéről való disszociációjának felel meg, vagy (ii) a második, reverzibilis lépés az első tetraéderes intermedier (TI 1 ) kialakulása, a harmadik lépés pedig az acilezés, amely a távozó csoportnak az enzim felszínéről való gyors disszociációjához kapcsolt, ezért irreverzibilis lépésként jelentkezik. Az a megfigyelés, hogy az umbelliferil távozó csoporttal rendelkező tripeptid szubsztrát analógok kitűnő szubsztrátjai a tripszinnek (Kuromizu és mtsi. 1985), arra utal, hogy a 4-metilumbelliferon nagyon gyorsan disszociál az enzim felszínéről, ezért az első feltételezést kizárhatjuk. Egy finomított reakciómechanizmust javaslunk tehát, melyben a szubsztrát kötését a TI 1 reverzibilis keletkezése követi, a harmadik, irreverzibilis esemény az acilezés, az utolsó reakciólépés pedig a dezacilezés. A sémában csillaggal jelöltem meg a fluoreszkáló specieseket. 2. modell A katalitikus ciklus első történése a MUGB reverzibilis kötése (k 1, k -1 ) a szubsztrátkötő helyhez, mely a nem-kovalens enzim-szubsztrát Michaelis komplex kialakulásához vezet. A kötési eseményt a Ser195 hidroxil csoportjának nukleofil támadása követi a hasadó észterkötésre, mely a TI 1 reverzibilis kialakulásához vezet (k 2, k -2 ). A harmadik lépés a TI 1 felbomlása (k 3a ) az első termékre (a 4-metilumbelliferonra, MU) és az acil-enzimre (a guanidinobenzoil-tripszinre, E-GB). Ez a lépés szorosan kapcsolt a fluoreszcens csoport gyors disszociációjával (k 3b ), ezért irreverzibilis lépésként jelentkezik. Az utolsó esemény a dezacilezés (k 4 ) egy aktivált vízmolekula által, amikor is a második termék (a guanidinobenzoát, GB) szintén távozik, és az enzim 93

94 visszanyeri aktív konformációját. A reakciómechanizmus utolsó lépése az enzim regenerálódásához vezet, amely beléphet a következő katalitikus ciklusba A G193R mutáció hatása az egyes reakciólépések sebességére Adataim arra utalnak, hogy a katalitikus ciklus minden lépését valamelyest érinti a mutáció. A K d értéke a harmadára csökken a mutáns enzimben, tehát a mutáció hatására nem változik meg jelentősen a szubsztrátkötés erőssége. Ezt az eredményt alátámasztja, hogy egy hasonló szerkezetű molekula, a benzamidin inhibíciós konstansa azonos ezen enzimek esetében (Medveczky és mtsi. 2003). Azt találtuk, hogy a tripszin MUGB-al való reakciója során az első tetraéderes intermedier (TI 1 ) (definícióját ld. 1.5 fejezet) kialakulása reverzibilis. Ezen reakciólépés egyensúlya 20 C-on erősebben el van tolva a termékképződés irányába, ha a 193-as pozíciót egy arginin foglalja el a glicin helyett. Meg kell azonban jegyeznünk, hogy mindkét enzimben a TI 1 kialakulása gyorsabb, mint az acilezési lépés. Ez nem egyedi reakciómechanizmus a proteázok között. A kimotripszin specifikus észter és tioészter szubsztrátok általi acilezésén alapuló kinetikai bizonyítékok (Hiroara és mtsi. 1974) és kvantumkémiai számolások is (Ishida és Kato 2003) a TI 1 reverzibilis képződősére utalnak. Azonban ezekben a tanulmányokban a TI 1 sebesség-meghatározó képződését írták le, melyet az acil-enzim azonnali képződése követ. Másfelől viszont egy nemrégiben megjelent, szubtilizin variánsokról szóló közleményben (Bott és mtsi. 2003) és egy másik, elasztázzal és α- lítikus proteázzal foglalkozó tanulmányban (Hunkapiller és mtsi. 1976) a TI 1 lebomlásának sebesség-meghatározó voltát írták le a hidrolítikus lépés során. A guanidinobenzoil-tripszin szerkezetének elemzéséből (1gbt, Mangel és mtsi. 1990) egyértelműen levonható a következtetés, hogy az acil-enzim kialakulása során a Ser195 β szénatomjának pozíciója számottevően (~0,7 Å-mel) elmozdul a szubsztrátkötő zseb felé, mivel a guanidinobenzoil csoport körülbelül 0,5 Å-mel rövidebb, mint egy P1 arginil oldallánc. Ezt az elmozdulást számos egyéb kisebb torzulás kíséri a fehérje szerkezetében, amelyek következtében az acil-enzim extrém stabillá válik. Felvetésünk szerint ezek a szerkezeti átrendeződések tükröződnek a k 3 alacsony értékében (a lassú acilezésben) és az acil-enzim komplex extrém stabilitásában mindkét enzim esetén. Az acilezés kissé (3-4-szer) lassabb a vad típusú enzimben. Az acil-enzim komplex mindkét enzim esetében elbomlik, és a dezacilezés kismértékben (5-6-szor) gyorsabb a htry4 WT -ben, mint az R193G mutáns esetében. Az acil-enzim 94

95 komplex lassabb kialakulása és gyorsabb elbomlása miatt a MUGB nem használható a humán tripszin 4 aktívhely titrálására, és valószínűleg más, a 193-as pozícióban nemglicint hordozó szerin proteázok titrálására sem. Mivel az enzim szerkezete torzult az acil-enzim komplexben, vissza kell nyernie a natív konformációt a dezacilezés során. Ez a relaxáció gyorsabb a vad típusú enzimben, mert valószínűleg elősegítik olyan, a 193- as pozícióban glicinnel rendelkező variánsban meglévőhöz képest nagyobb mechanikai feszültségek, amelyek inherens módon jelen vannak a fehérjében, ha ezt a pozíciót egy arginin foglalja el A G193R mutáció hatása az első tetraéderes intermedier kialakulásának termodinamikájára Egy nemrégiben megjelent tanulmányban leírták a 193-as pozíció perturbálásának következményeit trombinban és patkány tripszinben (Bobofchak és mtsi. 2005). Ebben a munkában a reakciók profilját steady state körülmények között elemezték a k cat és K m Michaelis-Menten paraméterek meghatározásával, az elemi sebességi állandókat pedig ezen összetett paraméterek hőmérsékletfüggéséből vezették le. Ezzel szemben, tranziens kinetikai módszerek alkalmazásával az egyedi reakciólépések megbízhatóan szeparálhatók, közvetlenül detektálhatók, és sebességi állandójuk közvetlenül meghatározható. A legfontosabb különbég a vizsgált enzimek közt a TI 1 kialakulásának termodinamikájában van. A második reakciólépés energetikáját a termékképződés irányába mutató (k 2 ) és a termék visszaalakulása irányába mutató (k -2 ) sebességi állandók és az egyensúlyi állandó (K 2 ) hőmérsékletfüggésének vizsgálatával határoztam meg (20. és 21. ábra). Az adatok alapján a TI 1 kialakulásának egyensúlyi folyamata az R193G mutáns humán tripszinben egy endoterm folyamat és az entrópia kismértékű növekedése hajtja. Ez arra utal, hogy csak mérsékelt szerkezeti és dinamikai átrendeződések történnek az R193G mutáns enzimben a TI 1 keletkezése során. Ezzel szemben, a vad típusú enzimben ez a reakciólépés erősen exoterm és nagy entrópiacsökkenés kíséri, ami kiterjedt szerkezeti átrendeződésekre utal a TI 1 kialakulásának egyensúlyi lépése során. A feltételezett szerkezeti átrendeződések vonatkozhatnak az enzimen túl a ligandra, illetve az enzim hidrátburkára is. Mivel a termékképződés irányába mutató reakciólépés (k 2 ) termodinamikája hasonló a két 95

96 enzimben, a különbség főként a termék visszaalakulása irányába mutató reakció (k -2 ) eltéréséből ered. Az arginin jelenléte a 193-as pozícióban feszültséget vihet be az aktív tripszin peptidgerincébe, ami magyarázatul szolgálhat a TI 1 képződés termodinamikájában talált különbségért. Egy korábbi, a XI-es faktorról készült tanulmányban a vad típusú enzim szerkezetét összehasonlították a G193E mutáns homológia modelljének szerkezetével (Schmidt és mtsi. 2004). Bemutatták, hogy a 193-as pozícióba a glutaminsav könnyedén beilleszkedik a N-C α és C α -C kötések körül való elfordulás révén szignifikáns szerkezeti változás okozása nélkül, mégis perturbálva az S1 kötőhelyet és az oxianion lyukat. Hasonló magyarázat a humán tripszin 4-re is érvényes lehet. Felvetésünk szerint egy nem-glicin aminosav ebben a pozícióban nem okoz jelentős változásokat az aktív enzim szerkezetében, de mechanikai feszültséget ébreszt, amely felfedhető termodinamikai elemzéssel. Továbbá erre a feltételezésre utalnak azon kísérleteimben kapott eredmények is, melyekben ph-ugrásos tranziens kinetikai mérésekkel a vad típusú humán tripszin 4 inaktív konformációból az aktív konformációba való szerkezeti átmenetének sebességi állandója kisebbnek bizonyult, mint az R193G mutánsé (ld. 5.5 fejezet). Mivel az aktiváció során a 193-as pozíció körül nagy elfordulás történik, a kisebb sebességi állandó szerkezeti vagy mechanikai feszültség jelentétére utal a peptidgerinc es szakaszában. Következtetésünk szerint a vad típusú humán tripszin 4-ben kiterjedt szerkezeti átrendeződések történnek a TI 1 kialakulása során, új kölcsönhatások alakulnak ki, melyek korlátozzák az intermedier dinamikáját, ezáltal csökkentik az entrópiát. A humán tripszin 4 nem-konvencionális szerkezeti és kinetikai tulajdonságai hozzájárulhatnak ezen enzim funkciójához a központi idegrendszerben fiziológiás és/vagy patológiás folyamatokban. 96

97 5.5 A ph-ugrással kiváltott aktiváció során bekövetkező konformációváltozás gyorskinetikai vizsgálata és termodinamikájának elemzése Az aktiváció során a szerin proteázok aktivációs doménje konformációváltozáson megy keresztül, amely a stabilizáló sóhíd perturbálása révén kiváltható ph-ugrással. A folyamat jól követhető, mivel a fehérjében belső jelváltozás kíséri. Célom volt, hogy tanulmányozzam a 193-as pozícióban elhelyezkedő csukló régiót érintő pontmutációk hatását az aktiváció során bekövetkező konformációváltozás sebességére és termodinamikájára. Expresszáltam a vad típusú és a 193-as pozícióban különböző méretű oldalláncú aminosavval rendelkező mutáns humán tripszin 4 variánsokat és követtem az aktiváció során történő konformációváltozásukat a hőmérséklet és az oldat viszkozitásának függvényében ph-ugrásos stopped flow kísérletekben a triptofán fluoreszcencia változást detektálva A vad típusú és 193-as pozícióban mutáns humán tripszin 4 variánsok steady state aktivitása Doktori dolgozatom ezen részében a kísérletekhez a vad típusú humán tripszin 4-et és ennek mutánsait használtam, melyekben a 193-as pozíciójú arginint glicin, alanin, fenilalanin illetve tirozin helyettesítette. Hogy megvizsgáljuk, ezek a mutációk befolyásolják-e az enzimatikus aktivitást, megmértük ezeknek a variánsoknak a katalitikus aktivitását amid kötés hidrolízise során Z-Gly-Pro-Arg-pNA szubsztráton. A Michaelis-Menten paraméterek értékeit a IV. táblázatban foglalom össze. 97

98 k cat (s -1 ) K m (µm) k cat /K m (s -1 µm -1 ) R193G 110 ± 10 13,5 ± 2,5 8,17 ± 1,68 R193A 124 ± 4 19,8 ± 3,2 6,23 ± 1,02 WT 158 ± 8 25,2 ± 0,6 6,27 ± 0,36 R193F 162 ± 5 27,4 ± 6,7 5,90 ± 1,45 R193Y 133 ± 6 21,3 ± 6,1 6,21 ± 1,80 IV. táblázat A vad típusú és 193-as pozícióban mutáns humán tripszin 4 Z-Gly-Pro-Arg-pNA amid szubsztrát hidrolízisének Michaelis-Menten paraméterei. A méréseket 50 mm Tricin, ph 8,0, 10 mm CaCl 2 pufferben végeztem a 4.8 fejezetben leírtak szerint. A Michaelis-Menten paraméterek értékei három mérés átlagát és standard hibáját reprezentálják. Adataink azt mutatják, hogy a mutációk csak enyhe változásokat okoztak a k cat és a K m értékében. A K m értékben a legnagyobb változás 50%-on belül van, a k cat érték esetében pedig nem haladja meg a 30%-ot. A glicin nagyobb oldalláncú aminosavra való cseréjének hatására a k cat értéke nő, és a növekedés mértéke korrelál az oldallánc méretével. Ugyanez a megfigyelés igaz a K m értékre is. Az aminosavcserék hatására a legnagyobb változás a k cat /K m értékben 30%, ezért ezek a 193-as pozícióban mutáns variánsok mind aktív enzimnek tekinthetők. Ezek az eredmények arra utalnak, hogy a Z-Gly-Pro-Arg-pNA szubsztrát kötését és hidrolízisének katalízisét is csak kismértékben befolyásolják ezek a mutációk A ph-ugrással kiváltott aktiváció során bekövetkező konformációváltozás kinetikai elemzése Az aktiváció során bekövetkező konformációs átrendeződés sebességét ph-ugrásos stopped flow kísérletekben vizsgáltam a fehérjék belső fluoreszcenciájának követésével. Ezekben a kísérletekben a stopped flow egyik fecskendője tartalmazta az enzimet egy relatíve kis pufferkapacitású 11-es ph-jú pufferben, a másik fecskendőbe pedig erős pufferkapacitású 8-as ph-jú puffert töltöttem. A keverés után az oldat ph-ja 8,0 ± 0,1 volt. Ez a ph-ugrás váltotta ki a szerkezeti átrendeződést, melyet a triptofán fluoreszcencia változásának mérésével követtem. Adataim azt mutatják, hogy a konformációváltozás sebességét befolyásolják a 193-as pozíciót érintő mutációk. A 98

99 193-as variánsok sebességi állandói 20 C-on a következők: k R193G = 1,66 s -1, k R193A = 0,20 s -1, k WT = 0,077 s -1, k R193Y = 0,13 s -1, k R193F = 0,090 s -1. Itt jegyzem meg, hogy a vad típusú, az R193Y és az R193F mutánsok esetén egy burst fázist is detektáltunk, melynek amplitúdója a teljes fluoreszcenciaváltozás 11-16% között volt, sebességi állandója pedig 7-17-szer nagyobb volt, mint az analizált domináns fázisé A ph-ugrással kiváltott aktiváció során bekövetkező konformációváltozás termodinamikájának vizsgálata A konformációs átmenet sebességének hőmérsékletfüggése Az aktiváció során bekövetkező konformációváltozás termodinamikájának tanulmányozása céljából megmértem a sebességi állandók hőmérsékletfüggését. A konformációváltozás termodinamikai paramétereit a nem-linearizált Arrhenius ábrázolásból (k ábrázolva a T függvényében) származtattam, és az V. táblázatban foglalom össze. 99

100 22. ábra A vad típusú ( ) és az R193G ( és ), R193A ( és ), R193F ( ) és R193Y ( ) mutáns humán tripszin 4 aktivációja során bekövetkező konformációváltozás sebességi állandójának Arrhenius ábrázolása (ln k ábrázolva az 1/T függvényében). A sebességi állandókat stopped flow, illetve hőugrásos stopped flow kísérletekkel határoztam meg. A konformációváltozás sebességét a 5-38 C-os hőmérsékleti tartományban egy konvencionális készülékkel határoztam meg 3 C-onként (teli szimbólumok). 12 ml/sec áramlási sebességet alkalmaztam, és 40 µl térfogatokat kevertem össze 1:1 arányban. 1-4 µm 20 mm CABS, ph 11,0 ± 0,1, 10 mm CaCl 2 pufferben oldott enzimet kevertem össze 100 mm Tricin, ph 8,0 ± 0,1, 10 mm CaCl 2 pufferrel, és követtem a fluoreszcencia emisszió intenzitásának változását. A C-os hőmérsékleti tartományban egy új, Málnási-Csizmadia András laborjában kifejlesztett hőugrásos stopped flow készülékkel mértem, hogy kiterjesszem az R193G és az R193A variáns Arrhenius ábrázolását (nyitott szimbólumok). A hőugrásos méréseknél 20 µl 20 mm CABS, ph 11,0 ± 0,1, 10 mm CaCl 2 pufferben oldott enzimet kevertem össze 100 µl 100 mm Tricin, ph 8,0 ± 0,1, 10 mm CaCl 2 pufferrel. A termodinamikai paramétereket az adatokra illesztett y = a exp( b/ x) exponenciális függvények paramétereiből határoztam meg a fejezetben leírtak szerint. Az Arrhenius ábrázolások (ln k ábrázolva az 1/T függvényében) lineárisak voltak az 5-45 C-os hőmérsékleti tartományban (22. ábra). Az adatokat Eyring ábrázolással is elemeztük, melyben a preexponenciális faktor hőmérsékletfüggő, és az illesztés megbízhatósága (χ négyzete) nem változott szignifikánsan. Ezenkívül nem találtunk jelentős különbséget az illesztés megbízhatóságában akkor sem, mikor a víz viszkozitásának hőmérsékletfüggésével korrigált Kramers egyenletet illesztettük az adatokra. Legfontosabb felismerésünk az, hogy az Arrhenius ábrázolások lefutása párhuzamos a humán tripszin as variánsai esetén. Ez azt mutatja, hogy a konformációs átmenet aktiválási energiáját (E a ) nem befolyásolják az aminosavcserék. Ezért az illesztett exponenciális függvények b kitevője (a linearizált Arrhenius ábrázolások meredeksége) gyakorlatilag azonos (22. ábra, V. táblázat). A legnagyobb 100

101 különbséget az aktiválási energiákban a vad típusú és az R193F mutáns humán tripszin között találtam, mely 4%-ot tesz ki. A többi mutáns aktiválási energiája mindössze 0,8-2%-kal tért el egymástól. Ezzel szemben, a linearizált Arrhenius ábrázolások tengelymetszete jelentősen eltérő a vizsgált enzimvariánsoknál, ami arra utal, hogy ezek a mutációk szelektíven megváltoztatják az Arrhenius egyenlet preexponenciális tagját. A legnagyobb különbség az R193G és az R193F mutáns között található, az eltérés 26-szoros (V. táblázat). R193G R193A WT R193F R193Y b -(10,4 ± 0,4) -(10,7 ± 0,2) -(10,8 ± 0,3) -(10,3 ± 0,2) -(10,5 ± 0,3) E a (kjmol -1 ) 86,5 ± 3,4 88,7 ± 1,6 89,5 ± 2,4 85,7 ± 1,9 87,2 ± 2,7 a = A 3, , , , , V. táblázat A vad típusú és a 193-as pozícióban mutáns humán tripszin 4 variánsok nem-linearizált Arrhenius ábrázolásokból származtatott termodinamikai paraméterei. A ph-ugrással kiváltott aktiváció során bekövetkező konformációváltozás sebességét stopped flow készülékkel mértem meg a fehérjék belső fluoreszcencia emisszió változását követve. A kísérleti körülményeket a és fejezetben írtam le. A reakciósebességeket az 5-38 C-os (illetve az R193G és az R193A mutáns esetében a 6-60 C-os) hőmérsékleti tartományban 3 C-onként mértem meg. A sebességi állandókat ábrázoltam a hőmérséklet függvényében, majd az y = a exp( b/ x) függvényt illesztettem az adatokra. A termodinamikai paramétereket az illesztett függvény a és b paraméteréből származtattam a fejezetben leírtak szerint. Az értékek az illesztett függvények paramétereinek átlagát és standard hibáját reprezentálják. Az új hőugrásos stopped flow készülék kifejlesztése (Kintses és mtsi. 2006) lehetővé tette, hogy kiterjesszem az Arrhenius ábrázolásokat 60 C-ig. A lineáris függvénytől való eltérés figyelhető meg 45 C felett (22. ábra), ami egy másik reakciólépés jelenlétére utal. Meg kell jegyezni azonban, hogy a hődenaturáció C-on a tízmásodperces időskálán történik, amit a fluoreszcencia intenzitás csökkenéseként lehetett detektálni, míg az aktiváció ezeken a hőmérsékleteken több mint egy nagyságrenddel gyorsabb folyamat. 101

102 A konformációs átmenet sebességének függése a reakcióközeg viszkozitásától A mutációk preexponenciális tagra való hatásának részletesebb vizsgálata céljából kísérleteket végeztem, melyben a pufferek relatív viszkozitását megváltoztattam. Kérdésem az volt, hogy a konformációváltozás sebességi állandója csökken-e az oldószer viszkozitásának növekedésével, mint ahogyan azt a Kramers elmélet jósolja. Hogy megválaszoljam a kérdést, ph-ugrásos stopped flow kísérleteket végeztem az R193G és az R193A mutánsokon különböző relatív viszkozitású pufferekben 1-től 8,2-ig 20 C-on. A megnövekedett oldószer viszkozitásnak drámai hatása volt a konformációváltozás sebességére mindkét mutáns esetében (23. ábra): 2-es relatív külső viszkozitásnál a sebességi állandó 45, illetve 36%-al csökkent az R193G illetve az R193A mutáns esetén. 102

103 23. ábra Stopped flow mérések a humán tripszin R193G (A) és R193A (B) mutánsának ph ugrással kiváltott aktivációjáról, különböző relatív viszkozitású pufferekben. 1-4 µm 10 mm CABS, ph 11,0, 5 mm CaCl 2 pufferben oldott enzimet kevertem össze 50 mm Tricin, ph 8,0, 5 mm CaCl 2 pufferrel 20 C-on. Mindkét puffert adott koncentrációjú maltózzal egészítettem ki, hogy különböző relatív viszkozitású oldatokat kapjak. Követtem a fluoreszcencia emisszió változást és a felvett görbékre egyszeres exponenciálisokat illesztettem. A konformációs átmenet sebességi állandója csökkent az oldószer megnövelt viszkozitása hatására. A bemutatott görbék megfigyelt sebességi állandója a következő: k R193G relatív viszkozitás 1 = 1,65 s -1, k R193G relatív viszkozitás 4,4 = 0,39 s -1, k R193A relatív viszkozitás 1 = 0,22 s -1 és k R193A relatív viszkozitás 2,2 = 0,095 s -1. A megfigyelt sebességi állandók és a külső viszkozitás között hiperbolikus összefüggést találtam mindkét mutáns esetén, ami megerősíti a Kramers elmélet erre a két 103

104 meghatározott konformer közötti konformációváltozásra való alkalmazásának érvényességét. A sebességi állandók reciprokát ábrázoltam a relatív külső viszkozitás függvényében, és lineáris függvényeket illesztettem az adatokra (24. ábra). 24. ábra Az aktiváció során bekövetkező konformációváltozás sebességi állandójának függése a külső viszkozitástól az R193A ( ) és az R193G ( ) mutáns humán tripszin 4 esetén. A stopped flow méréseket 20 C-on végeztem 10 mm CABS, ph 11,0, 5 mm CaCl 2, és 50 mm Tricin, ph 8,0, 5 mm CaCl 2, puffereket használva, melyeket 0-1,46 M maltózzal egészítettem ki, hogy különböző relatív viszkozitású oldatokat kapjak 1-től 8,2-ig. Az 1/k értékeket ábrázoltam a relatív külső viszkozitás függvényében, majd lineáris függvényeket illesztettem a mérési adatokra. A relatív belső viszkozitásokat az illesztett egyenesek tengelymetszetéből és meredekségéből számoltam a 8. egyenlet szerint. Az illesztett egyenesek paramétereit és a 9. egyenlet alapján ezekből számolt relatív belső viszkozitás értékeket a VI. táblázatban mutatom be. 104

A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban

A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban Doktori (PhD) értekezés Siklódi Erika Rozália Biológia Doktori Iskola Iskolavezető: Prof. Erdei Anna, tanszékvezető egyetemi

Részletesebben

Enzimek. Enzimek! IUBMB: szisztematikus nevek. Enzimek jellemzése! acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás. szubsztrát-specificitás

Enzimek. Enzimek! IUBMB: szisztematikus nevek. Enzimek jellemzése! acetilkolin-észteráz! legalább 10 nagyságrend gyorsulás. szubsztrát-specificitás Enzimek acetilkolin-észteráz! Enzimek! [s -1 ] enzim víz carbonic anhydrase 6x10 5 10-9 karbonikus anhidráz acetylcholine esterase 2x10 4 8x10-10 acetilkolin észteráz staphylococcal nuclease 10 2 2x10-14

Részletesebben

DER (Felületén riboszómák találhatók) Feladata a biológiai fehérjeszintézis Riboszómák. Az endoplazmatikus membránrendszer. A kódszótár.

DER (Felületén riboszómák találhatók) Feladata a biológiai fehérjeszintézis Riboszómák. Az endoplazmatikus membránrendszer. A kódszótár. Az endoplazmatikus membránrendszer Részei: DER /durva (szemcsés) endoplazmatikus retikulum/ SER /sima felszínű endoplazmatikus retikulum/ Golgi készülék Lizoszómák Peroxiszómák Szekréciós granulumok (váladékszemcsék)

Részletesebben

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet

Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét. Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Fehérje szintézis 2. TRANSZLÁCIÓ Molekuláris biológia kurzus 7. hét Kun Lídia Genetikai, Sejt- és immunbiológiai Intézet Gén mrns Fehérje Transzkripció Transzláció A transzkriptum : mrns Hogyan mutatható

Részletesebben

3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció

Részletesebben

Doktori értekezés. Kiss András László 2007. Témavezető: Polgár László professzor. 1. oldal

Doktori értekezés. Kiss András László 2007. Témavezető: Polgár László professzor. 1. oldal Doktori értekezés Kiss András László 2007 Témavezető: Polgár László professzor 1. oldal Acylaminoacyl peptidáz enzimek katalízisének vizsgálata A dolgozatot készítette: Biológia Doktori Iskola Szerkezeti

Részletesebben

A polipeptidlánc szabályozott lebontása: mit mondanak a fehérjekristályok? Harmat Veronika ELTE Kémiai Intézet, Szerkezeti Kémia és Biológia Laboratórium MTA-ELTE Fehérjemodellező Kutatócsoport A magyar

Részletesebben

Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az

Részletesebben

A fehérjék hierarchikus szerkezete

A fehérjék hierarchikus szerkezete Fehérjék felosztása A fehérjék hierarchikus szerkezete Smeller László Semmelweis Egyetem Biofizikai és Sugárbiológiai Intézet Biológiai funkció alapján Enzimek (pl.: tripszin, citokróm-c ) Transzportfehérjék

Részletesebben

A KIMOTRIPSZIN C SZABÁLYOZÓ SZEREPÉNEK ÉS N-GLIKOZILÁCIÓJÁNAK VIZSGÁLATA

A KIMOTRIPSZIN C SZABÁLYOZÓ SZEREPÉNEK ÉS N-GLIKOZILÁCIÓJÁNAK VIZSGÁLATA A KIMOTRIPSZIN C SZABÁLYOZÓ SZEREPÉNEK ÉS N-GLIKOZILÁCIÓJÁNAK VIZSGÁLATA Doktori értekezés Bence Melinda Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola Pathobiokémia Doktori Program Témavezető:

Részletesebben

Kutatási eredményeim a 2014 február 1- augusztus 31. a Varga József Alapítvány Pungor Ernő doktorjelölti ösztöndíjas időszak során

Kutatási eredményeim a 2014 február 1- augusztus 31. a Varga József Alapítvány Pungor Ernő doktorjelölti ösztöndíjas időszak során Kutatási eredményeim a 2014 február 1- augusztus 31. a Varga József Alapítvány Pungor Ernő doktorjelölti ösztöndíjas időszak során 1. projekt Kvaterner ammónium ligandot használó enzimek ligand kötőhelyének

Részletesebben

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak

Aminosavak általános képlete NH 2. Csoportosítás: R oldallánc szerkezete alapján: Semleges. Esszenciális aminosavak Aminosavak 1 Aminosavak általános képlete N 2 soportosítás: oldallánc szerkezete alapján: Apoláris Poláris Bázikus Savas Semleges Esszenciális aminosavak 2 (apoláris) Glicin Név Gly 3 Alanin Ala 3 3 Valin

Részletesebben

A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata

A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata Ph.D. ÉRTEKEZÉS TÉZISEI A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata Buzás-Bereczki Orsolya Témavezetők: Dr. Bálint Éva Dr. Boros Imre Miklós Biológia

Részletesebben

Bioinformatika 2 5.. előad

Bioinformatika 2 5.. előad 5.. előad adás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 03. 21. Fehérje térszerkezet t megjelenítése A fehérjék meglehetősen összetett

Részletesebben

A fehérje-fehérje kölcsönhatás szerkezeti alapjai és biológiai szerepük: multidiszciplináris megközelítés (zárójelentés)

A fehérje-fehérje kölcsönhatás szerkezeti alapjai és biológiai szerepük: multidiszciplináris megközelítés (zárójelentés) A fehérje-fehérje kölcsönhatás szerkezeti alapjai és biológiai szerepük: multidiszciplináris megközelítés (zárójelentés) Az ELTE Biokémiai Tanszék tudományos kutatásainak tengelyében évtizedek óta a fehérjék

Részletesebben

TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL

TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL Az egyes biomolekulák izolálása kulcsfontosságú a biológiai szerepük tisztázásához. Az affinitás kromatográfia egyszerűsége, reprodukálhatósága

Részletesebben

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános A sejtek élete 5. Robotoló törpék és óriások Az aminosavak és fehérjék e csak nézd! Milyen protonátmenetes reakcióra képes egy aminosav? R 2 5.1. A fehérjeépítőaminosavak általános képlete 5.2. A legegyszerűbb

Részletesebben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK

Részletesebben

TRANSZPORTFOLYAMATOK 1b. Fehérjék. 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS

TRANSZPORTFOLYAMATOK 1b. Fehérjék. 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS 1b. FEHÉRJÉK TRANSZPORTJA A MEMBRÁNONOKBA ÉS A SEJTSZERVECSKÉK BELSEJÉBE ÁLTALÁNOS DIA 1 Fő fehérje transzport útvonalak Egy tipikus emlős sejt közel 10,000 féle fehérjét tartalmaz (a test pedig összesen

Részletesebben

A fehérjék szerkezete és az azt meghatározó kölcsönhatások

A fehérjék szerkezete és az azt meghatározó kölcsönhatások A fehérjék szerkezete és az azt meghatározó kölcsönhatások 1. A fehérjék szerepe az élõlényekben 2. A fehérjék szerkezetének szintjei 3. A fehérjék konformációs stabilitásáért felelõs kölcsönhatások 4.

Részletesebben

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet.

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet. A fehérjék harmadlagos vagy térszerkezete Még a globuláris fehérjék térszerkezete is sokféle lehet. A ribonukleáz redukciója és denaturálódása Chrisian B. Anfinsen A ribonukleáz renaturálódása 1972 obel-díj

Részletesebben

Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 3. előadás Az immunrendszer molekuláris elemei: antigén, ellenanyag, Ig osztályok Az antigén meghatározása Detre László: antitest generátor - Régi meghatározás:

Részletesebben

9. Előadás Fehérjék Előzmények Peptidkémia Analitikai kémia Protein kémia 1901 E.Fischer : Gly-Gly 1923 F. Pregl : Mikroanalitika 1952 Stein and Moore : Aminosav analizis 1932 Bergman és Zervas : Benziloxikarbonil

Részletesebben

A replikáció mechanizmusa

A replikáció mechanizmusa Az öröklődés molekuláris alapjai A DNS megkettőződése, a replikáció Szerk.: Vizkievicz András A DNS-molekula az élőlények örökítő anyaga, kódolt formában tartalmazza mindazon információkat, amelyek a sejt,

Részletesebben

INFORMATIKA EMELT SZINT%

INFORMATIKA EMELT SZINT% Szövegszerkesztés, prezentáció, grafika, weblapkészítés 1. A fényképezés története Táblázatkezelés 2. Maradékos összeadás Adatbázis-kezelés 3. Érettségi Algoritmizálás, adatmodellezés 4. Fehérje Maximális

Részletesebben

kutatás során legfőbb eredményeinket a szerin proteázok aktiválódásának mechanizmusával és az aktiválódás fiziológiai következményeinek

kutatás során legfőbb eredményeinket a szerin proteázok aktiválódásának mechanizmusával és az aktiválódás fiziológiai következményeinek Fehérjék konformációs flexibilitása mint a biomolekuláris felismerés és a jeltovábbítás alapvető eleme (OTKA NK 77978) Zárójelentés (2009. ápr. 1-től 2013. márc. 31-ig) A biológiai rendszerek önszerveződésének

Részletesebben

CzB 2010. Élettan: a sejt

CzB 2010. Élettan: a sejt CzB 2010. Élettan: a sejt Sejt - az élet alapvető egysége Prokaryota -egysejtű -nincs sejtmag -nincsenek sejtszervecskék -DNS = egy gyűrű - pl., bactériumok Eukaryota -egy-/többsejtű -sejmag membránnal

Részletesebben

Genomadatbázisok Ld. Entrez Genome: Összes ismert genom, hierarchikus szervezésben (kromoszóma, térképek, gének, stb.)

Genomadatbázisok Ld. Entrez Genome: Összes ismert genom, hierarchikus szervezésben (kromoszóma, térképek, gének, stb.) Genomika Új korszak, paradigmaváltás, forradalom: a teljes genomok ismeretében a biológia adatokban gazdag tudománnyá válik. Új kutatási módszerek, új szemlélet. Hajtóerõk: Genomszekvenálási projektek

Részletesebben

A HASNYÁLMIRIGY EREDETŰ TRIPSZIN INHIBITOR (SPINK1) PATHOBIOKÉMIÁJA

A HASNYÁLMIRIGY EREDETŰ TRIPSZIN INHIBITOR (SPINK1) PATHOBIOKÉMIÁJA A HASNYÁLMIRIGY EREDETŰ TRIPSZIN INHIBITOR (SPINK1) PATHOBIOKÉMIÁJA Doktori értekezés Király Orsolya Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola Pathobiokémia Doktori Program Témavezető:

Részletesebben

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 NÖVÉNYÉLETTAN Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 Sejtfal szintézis és megnyúlás Környezeti tényezők hatása a növények növekedésére és fejlődésére Előadás áttekintése

Részletesebben

Az ABCG2 multidrog transzporter fehérje szerkezetének és működésének vizsgálata

Az ABCG2 multidrog transzporter fehérje szerkezetének és működésének vizsgálata Az ABCG2 multidrog transzporter fehérje szerkezetének és működésének Kutatási előzmények Az ABC transzporter membránfehérjék az ATP elhasítása (ATPáz aktivitás) révén nyerik az energiát az általuk végzett

Részletesebben

A Globális regulátor mutációknak mint az attenuálás lehetőségének vizsgálata Escherichia coli-ban

A Globális regulátor mutációknak mint az attenuálás lehetőségének vizsgálata Escherichia coli-ban A Globális regulátor mutációknak mint az attenuálás lehetőségének vizsgálata Escherichia coli-ban című támogatott kutatás fő célja az volt, hogy olyan regulációs mechanizmusoknak a virulenciára kifejtett

Részletesebben

Molekuláris genetikai vizsgáló. módszerek az immundefektusok. diagnosztikájában

Molekuláris genetikai vizsgáló. módszerek az immundefektusok. diagnosztikájában Molekuláris genetikai vizsgáló módszerek az immundefektusok diagnosztikájában Primer immundefektusok A primer immundeficiencia ritka, veleszületett, monogénes öröklődésű immunhiányos állapot. Családi halmozódást

Részletesebben

Közlemények... 4. Köszönetnyilvánítás... 5. Bevezetés... 7. 2 Célkitűzések... 43

Közlemények... 4. Köszönetnyilvánítás... 5. Bevezetés... 7. 2 Célkitűzések... 43 TARTALOMJEGYZÉK Közlemények... 4 Köszönetnyilvánítás... 5 Bevezetés... 7 1 Irodalmi áttekintés... 9 1.1 A komplementrendszer... 9 1.1.1 Története és jelentőségének felismerése... 9 1.1.2 Felépítése és

Részletesebben

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai A BIOLÓGIA ALAPJAI A tananyag felépítése: Környezetmérnök és műszaki menedzser hallgatók számára Előadó: 2 + 0 + 0 óra, félévközi számonkérés 3 ZH: október 3, november 5, december 5 dr. Pécs Miklós egyetemi

Részletesebben

Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai

Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai Az áramlási citométer és sejtszorter felépítése és működése Kereskedelmi forgalomban kapható készülékek 1 Fogalmak

Részletesebben

Hamar Péter. RNS világ. Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. www.meetthescientist.hu 1 26

Hamar Péter. RNS világ. Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. www.meetthescientist.hu 1 26 Hamar Péter RNS világ Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. 1 26 Főszereplők: DNS -> RNS -> fehérje A kód lefordítása Dezoxy-ribo-Nuklein-Sav: DNS az élet kódja megkettőződés (replikáció)

Részletesebben

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis

Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis. Fehérjeszerkezet analízis Szerkezet Protein Data Bank (PDB) http://www.rcsb.org/pdb ~ 35 701 szerkezet közepes felbontás 1552 szerkezet d 1.5 Å 160 szerkezet d 1.0 Å 10 szerkezet d 0.8 Å (atomi felbontás) E globális minimum? funkció

Részletesebben

Az oligopeptidázok szerkezete és működése: katalízis az S9A enzimcsaládban

Az oligopeptidázok szerkezete és működése: katalízis az S9A enzimcsaládban Az oligopeptidázok szerkezete és működése: katalízis az S9A enzimcsaládban Doktori értekezés Juhász Tünde Eötvös Loránd Tudományegyetem Biológia Doktori Iskola Iskolavezető: Prof. Erdei Anna, MTA levelező

Részletesebben

CIÓ A GENETIKAI INFORMÁCI A DNS REPLIKÁCI

CIÓ A GENETIKAI INFORMÁCI A DNS REPLIKÁCI A GENETIKAI INFORMÁCI CIÓ TÁROLÁSA ÉS S KIFEJEZŐDÉSE A DNS SZERKEZETE Két antiparalel (ellentétes lefutású) polinukleotid láncból álló kettős helix A két lánc egy képzeletbeli közös tengely körül van feltekeredve,

Részletesebben

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr

ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával. www.chem.elte.hu/pr ALKÍMIA MA Az anyagról mai szemmel, a régiek megszállottságával www.chem.elte.hu/pr Kvíz az előző előadáshoz 1) Mikor kapott Paul Ehrlich orvosi Nobel-díjat? A) Idén. B) Pont 100 éve, 1908-ban. C) Nem

Részletesebben

A Ca2+-ion hatása a szarvasmarha kimotripszin aktivitására, stabilitására, mozgékonyságára és szerkezetére

A Ca2+-ion hatása a szarvasmarha kimotripszin aktivitására, stabilitására, mozgékonyságára és szerkezetére Szakdolgozat A Ca2+-ion hatása a szarvasmarha kimotripszin aktivitására, stabilitására, mozgékonyságára és szerkezetére Készítette: Barabás Orsolya Témavezető: Náray-Szabó Gábor 2001 Köszönetnyilvánítás

Részletesebben

TÉMAKÖRÖK. Ősi RNS világ BEVEZETÉS. RNS-ek tradicionális szerepben

TÉMAKÖRÖK. Ősi RNS világ BEVEZETÉS. RNS-ek tradicionális szerepben esirna mirtron BEVEZETÉS TÉMAKÖRÖK Ősi RNS világ RNS-ek tradicionális szerepben bevezetés BIOLÓGIAI MOLEKULÁK FEHÉRJÉK NUKLEINSAVAK DNS-ek RNS-ek BIOLÓGIAI MOLEKULÁK FEHÉRJÉK NUKLEINSAVAK DNS-ek RNS-ek

Részletesebben

Az enzimek katalitikus aktivitású fehérjék. Jellemzőik: bonyolult szerkezet, nagy molekulatömeg, kolloidális sajátságok, alakváltozás, polaritás.

Az enzimek katalitikus aktivitású fehérjék. Jellemzőik: bonyolult szerkezet, nagy molekulatömeg, kolloidális sajátságok, alakváltozás, polaritás. Enzimek Az enzimek katalitikus aktivitású fehérjék Jellemzőik: bonyolult szerkezet, nagy molekulatömeg, kolloidális sajátságok, alakváltozás, polaritás. Az enzim lehet: csak fehérje: Ribonukleáz A, lizozim,

Részletesebben

Transzláció. Leolvasás - fehérjeszintézis

Transzláció. Leolvasás - fehérjeszintézis Transzláció Leolvasás - fehérjeszintézis Fehérjeszintézis DNS mrns Transzkripció Transzláció Polipeptid A trns - aminosav kapcsolódás 1 A KEZDETEK ELŐTT Az enzim aktiválja az aminosavat azáltal, hogy egy

Részletesebben

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ AMINOSAVAK ANYAGCSERÉJE 1. kulcsszó cím: Az aminosavak szerepe a szervezetben

MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ AMINOSAVAK ANYAGCSERÉJE 1. kulcsszó cím: Az aminosavak szerepe a szervezetben Modul cím: MEDICINÁLIS ALAPISMERETEK BIOKÉMIA AZ AMINOSAVAK ANYAGCSERÉJE 1. kulcsszó cím: Az aminosavak szerepe a szervezetben A szénhidrátokkal és a lipidekkel ellentétben szervezetünkben nincsenek aminosavakból

Részletesebben

Anaerob fermentált szennyvíziszap jellemzése enzimaktivitás-mérésekkel

Anaerob fermentált szennyvíziszap jellemzése enzimaktivitás-mérésekkel Eötvös Loránd Tudományegyetem Természettudományi Kar Környezettudományi Centrum Anaerob fermentált szennyvíziszap jellemzése enzimaktivitás-mérésekkel készítette: Felföldi Edit környezettudomány szakos

Részletesebben

A módszerek jelentősége. Gyors-kinetika módszerek. A módszerek közös tulajdonsága. Milyen módszerekről tanulunk?

A módszerek jelentősége. Gyors-kinetika módszerek. A módszerek közös tulajdonsága. Milyen módszerekről tanulunk? Gyors-kinetika módszerek módszerek jelentősége 2010. március 9. Nyitrai Miklós biológiai mechanizmusok megértése; iológiai folyamatok időskálája; Vándorló melanocita (Victor SMLL). ms skálán való mérések.

Részletesebben

(11) Lajstromszám: E 007 952 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA

(11) Lajstromszám: E 007 952 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000792T2! (19) HU (11) Lajstromszám: E 007 92 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 73892 (22) A bejelentés napja:

Részletesebben

Dózis-válasz görbe A dózis válasz kapcsolat ábrázolása a legáltalánosabb módja annak, hogy bemutassunk eredményeket a tudományban vagy a klinikai

Dózis-válasz görbe A dózis válasz kapcsolat ábrázolása a legáltalánosabb módja annak, hogy bemutassunk eredményeket a tudományban vagy a klinikai Dózis-válasz görbe A dózis válasz kapcsolat ábrázolása a legáltalánosabb módja annak, hogy bemutassunk eredményeket a tudományban vagy a klinikai gyakorlatban. Például egy kísérletben növekvő mennyiségű

Részletesebben

A sejtfelszíni receptorok három fő kategóriája

A sejtfelszíni receptorok három fő kategóriája A sejtfelszíni receptorok három fő kategóriája 1. Saját enzimaktivitás nélküli receptorok 1a. G proteinhez kapcsolt pl. adrenalin, szerotonin, glukagon, bradikinin receptorok 1b. Tirozin kinázhoz kapcsolt

Részletesebben

Aminosav anyagcsere. Dr. Vér Ágota Egyetemi docens 2012

Aminosav anyagcsere. Dr. Vér Ágota Egyetemi docens 2012 Aminosav anyagcsere Dr. Vér Ágota Egyetemi docens 2012 A NITROGÉN EGYENSÚLY Esszenciális és nem esszenciális aminosavak 1. Mennyiségi szükséglet Fehérje bevitel: 0,8 g/ts.kg /nap 1,0-1,1 g/ts.kg /nap :

Részletesebben

Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése

Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése Doktori tézisek Dr. Cserepes Judit Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola

Részletesebben

Fémionok szerepe az élő szervezetben: a bioszervetlen kémia alapjainak megismerése

Fémionok szerepe az élő szervezetben: a bioszervetlen kémia alapjainak megismerése Fémionok szerepe az élő szervezetben: a bioszervetlen kémia alapjainak megismerése Előadó: Lihi Norbert Debreceni Egyetem Szervetlen és Analitikai Kémiai Tanszék Bioszervetlen Kémiai Kutatócsoport A bioszervetlen

Részletesebben

Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén

Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Dr. Dallmann Klára A molekuláris biológia célja az élőlények és sejtek működésének molekuláris szintű

Részletesebben

Az Ig génátrendeződés

Az Ig génátrendeződés Az Ig génátrendeződés Háromféle változás játszódik le a molekula szerkezetét tekintve: B sejtek fejlődése alatt: VDJ átrendeződés (rekombináció) IgH izotípusváltás rekombináció (CSR) Szomatikus hipermutáció

Részletesebben

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 Élettan előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 oktató: Dr. Tóth Attila, adjunktus ELTE TTK Biológiai Intézet, Élettani és Neurobiológiai tanszék

Részletesebben

5. Molekuláris biológiai technikák

5. Molekuláris biológiai technikák 5. Molekuláris biológiai technikák DNS szaporítás kémcsőben és élőben. Klónozás, PCR, cdna, RT-PCR, realtime-rt-pcr, Northern-, Southernblotting, génexpresszió, FISH 5. Molekuláris szintű biológiai technikák

Részletesebben

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés

Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék. elrendeződés, rend, rendszer, periodikus ismétlődés Az élő anyag szerkezeti egységei: víz, nukleinsavak, fehérjék Agócs Gergely 2013. december 3. kedd 10:00 11:40 1. Mit értünk élő anyag alatt? Az élő szervezetet felépítő anyagok. Az anyag azonban nem csupán

Részletesebben

Pozitron emittáló izotópok. [18F]FDG előállítása. Általunk használt izotópok. Magreakció: Dual Beam 18F. Felezési idő (min) 109,7

Pozitron emittáló izotópok. [18F]FDG előállítása. Általunk használt izotópok. Magreakció: Dual Beam 18F. Felezési idő (min) 109,7 Pozitron emittáló izotópok [F]FDG előállítása Nuklid Felezési idő (min) 109,7 20,4 10 2,05 F 11C 13 N 15 2 Általunk használt izotópok Izotóp Molekula Mit mutat ki Fontosabb klinikai jelentősége F dezoxiglükóz

Részletesebben

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher

Részletesebben

A kromoszómák kialakulása előtt a DNS állomány megkettőződik. A két azonos információ tartalmú DNS egymás mellé rendeződik és egy kromoszómát alkot.

A kromoszómák kialakulása előtt a DNS állomány megkettőződik. A két azonos információ tartalmú DNS egymás mellé rendeződik és egy kromoszómát alkot. Kromoszómák, Gének A kromoszóma egy hosszú DNS szakasz, amely a sejt életének bizonyos szakaszában (a sejtosztódás előkészítéseként) tömörödik, így fénymikroszkóppal láthatóvá válik. A kromoszómák két

Részletesebben

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete

Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Peptid- és fehérjék másodlagos-, harmadlagos- és negyedleges szerkezete Polipeptidek térszerkezete Tipikus (rendezett) konformerek em tipikus (rendezetlen) konformerek Periodikus vagy homokonformerek Aperiodikus

Részletesebben

K68464 OTKA pályázat szakmai zárójelentés

K68464 OTKA pályázat szakmai zárójelentés K68464 OTKA pályázat szakmai zárójelentés A fehérjeaggregáció és amiloidképződés szerkezeti alapjai; a különféle morfológiájú aggregátumok kialakulásának körülményei és in vivo hatásuk vizsgálata Vezető

Részletesebben

Kutatási beszámoló 2006-2009. A p50gap intracelluláris eloszlásának és sejtélettani szerepének vizsgálata

Kutatási beszámoló 2006-2009. A p50gap intracelluláris eloszlásának és sejtélettani szerepének vizsgálata Kutatási beszámoló 6-9 Kutatásaink alapvetően a pályázathoz benyújtott munkaterv szerint történtek. Először ezen eredményeket foglalom össze. z eredeti tervektől történt eltérést a beszámoló végén összegzem.

Részletesebben

A citoszol szolubilis fehérjéi. A citoplazma matrix (citoszol) Caspase /Kaszpáz/ 1. Enzimek. - Organellumok nélküli citoplazma

A citoszol szolubilis fehérjéi. A citoplazma matrix (citoszol) Caspase /Kaszpáz/ 1. Enzimek. - Organellumok nélküli citoplazma A citoplazma matrix (citoszol) A citoszol szolubilis fehérjéi 1. Enzimek - Organellumok nélküli citoplazma -A sejt fejlődéstani szempontból legősibb része (a sejthártyával együtt) Glikolízis teljes enzimrendszere

Részletesebben

Módszer az ASEA-ban található reaktív molekulák ellenőrzésére

Módszer az ASEA-ban található reaktív molekulák ellenőrzésére Módszer az ASEA-ban található reaktív molekulák ellenőrzésére Az ASEA-ban található reaktív molekulák egy komplex szabadalmaztatott elektrokémiai folyamat, mely csökkenti és oxidálja az alap sóoldatot,

Részletesebben

4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek).

4. FEHÉRJÉK. 2. Vázanyagok. Az izmok alkotórésze (pl.: a miozin). Inak, izületek, csontok szerves komponensei, az ún. vázfehérjék (szkleroproteinek). 4. FEÉRJÉK 4.0. Bevezetés A fehérjék elsısorban α-l-aminosavakból felépülı biopolimerek. A csak α-laminosavakat tartalmazó fehérjék a proteinek. evüket a görög proteios szóból kapták, ami elsırangút jelent.

Részletesebben

Szerkesztette: Vizkievicz András

Szerkesztette: Vizkievicz András Fehérjék A fehérjék - proteinek - az élő szervezetek számára a legfontosabb vegyületek. Az élet bármilyen megnyilvánulási formája fehérjékkel kapcsolatos. A sejtek szárazanyagának minimum 50 %-át adják.

Részletesebben

Biomolekulák kémiai manipulációja

Biomolekulák kémiai manipulációja Biomolekulák kémiai manipulációja Bioortogonális reakciók Bio: biológiai rendszerekkel kompatibilis, ortogonális: kizárólag egymással reagáló funkciókat alkalmaz, melyek nem lépnek keresztreakcióba különböző

Részletesebben

Gáspári Zoltán. Élő molekulák az élet molekulái

Gáspári Zoltán. Élő molekulák az élet molekulái Gáspári Zoltán Élő molekulák az élet molekulái Invokáció Kajtár Márton 1929-1991 www.eotvoskiado.hu Élő és élettelen? Élő és élettelen: a kemoton Élő kémiai rendszer, de nem élőlény (Gánti, 1975) Autokatalitikus

Részletesebben

Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem

Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem Fehérjebiotechnológia Emri, Tamás Csősz, Éva Tőzsér, József Szerkesztette Tőzsér, József, Debreceni Egyetem Fehérjebiotechnológia írta Emri, Tamás, Csősz, Éva, Tőzsér, József, Tőzsér, József, és Szerzői

Részletesebben

VILÁGÍTÓ GYÓGYHATÁSÚ ALKALOIDOK

VILÁGÍTÓ GYÓGYHATÁSÚ ALKALOIDOK VILÁGÍTÓ GYÓGYHATÁSÚ ALKALIDK Biczók László, Miskolczy Zsombor, Megyesi Mónika, Harangozó József Gábor MTA Természettudományi Kutatóközpont Anyag- és Környezetkémiai Intézet Hordozóanyaghoz kötődés fluoreszcenciás

Részletesebben

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk.

A nukleinsavak polimer vegyületek. Mint polimerek, monomerekből épülnek fel, melyeket nukleotidoknak nevezünk. Nukleinsavak Szerkesztette: Vizkievicz András A nukleinsavakat először a sejtek magjából sikerült tiszta állapotban kivonni. Innen a név: nucleus = mag (lat.), a sav a kémhatásukra utal. Azonban nukleinsavak

Részletesebben

Hatékony tumorellenes készítmények előállítása target és drug molekulák kombinációjával (Zárójelentés)

Hatékony tumorellenes készítmények előállítása target és drug molekulák kombinációjával (Zárójelentés) Hatékony tumorellenes készítmények előállítása target és drug molekulák kombinációjával (Zárójelentés) Prof. Dr. Mező Gábor tudományos tanácsadó Kutatásunk célja az volt, hogy olyan biokonjugátumokat készítsünk,

Részletesebben

Fehérjeglikoziláció az endoplazmás retikulumban mint lehetséges daganatellenes támadáspont

Fehérjeglikoziláció az endoplazmás retikulumban mint lehetséges daganatellenes támadáspont Fehérjeglikoziláció az endoplazmás retikulumban mint lehetséges daganatellenes támadáspont Doktori tézisek Dr. Konta Laura Éva Semmelweis Egyetem Molekuláris Orvostudományok Tudományági Doktori Iskola

Részletesebben

Poligénes v. kantitatív öröklődés

Poligénes v. kantitatív öröklődés 1. Öröklődés komplexebb sajátosságai 2. Öröklődés molekuláris alapja Poligénes v. kantitatív öröklődés Azok a tulajdonságokat amelyek mértékegységgel nem, vagy csak nehezen mérhetők, kialakulásuk kevéssé

Részletesebben

2006 1. Nemszinaptikus receptorok és szubmikronos Ca2+ válaszok: A két-foton lézermikroszkópia felhasználása a farmakológiai vizsgálatokra.

2006 1. Nemszinaptikus receptorok és szubmikronos Ca2+ válaszok: A két-foton lézermikroszkópia felhasználása a farmakológiai vizsgálatokra. 2006 1. Nemszinaptikus receptorok és szubmikronos Ca 2+ válaszok: A két-foton lézermikroszkópia felhasználása a farmakológiai vizsgálatokra. A kutatócsoportunkban Közép Európában elsőként bevezetett két-foton

Részletesebben

4.3. FEHÉRJÉK ELŐÁLLÍTÁSA GÉNMANI- PULÁLT MIKROORGANIZMUSOKKAL. 1. Inzulin. Inzulin szerkezete

4.3. FEHÉRJÉK ELŐÁLLÍTÁSA GÉNMANI- PULÁLT MIKROORGANIZMUSOKKAL. 1. Inzulin. Inzulin szerkezete 4.3. FEHÉRJÉK ELŐÁLLÍTÁSA GÉNMANI- PULÁLT MIKROORGANIZMUSOKKAL A biotechnológiai ipar termékei: Elsődleges anyagcseretermékek Másodlagos anyagcseretermékek FEHÉRJÉK, amelyeket a sejt eredeti genomja nem

Részletesebben

TAKARMÁNYOZÁSTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010

TAKARMÁNYOZÁSTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 TAKARMÁNYOZÁSTAN Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 Takarmányok fehérjetartalma Az állati szervezet létfontosságú vegyületei fehérje természetűek Az állati termékek

Részletesebben

KARBONSAV-SZÁRMAZÉKOK

KARBONSAV-SZÁRMAZÉKOK KABNSAV-SZÁMAZÉKK Karbonsavszármazékok Karbonsavak H X Karbonsavszármazékok X Halogén Savhalogenid l Alkoxi Észter ' Amino Amid N '' ' Karboxilát Anhidrid Karbonsavhalogenidek Tulajdonságok: - színtelen,

Részletesebben

A Ca 2+ szerepe a tormaperoxidáz enzim aktív szerkezetében. Szigeti Krisztián

A Ca 2+ szerepe a tormaperoxidáz enzim aktív szerkezetében. Szigeti Krisztián A Ca 2+ szerepe a tormaperoxidáz enzim aktív szerkezetében Doktori értekezés Szigeti Krisztián Semmelweis Egyetem Gyógyszertudományok Doktori Iskola Témavezető: Hivatalos Bírálók: Szigorlati Bizottság

Részletesebben

A géntechnológia genetikai alapjai (I./3.)

A géntechnológia genetikai alapjai (I./3.) Az I./2. rész (Gének és funkciójuk) rövid összefoglalója A gének a DNS információt hordozó szakaszai, melyekben a 4 betű (ATCG) néhány ezerszer, vagy százezerszer ismétlődik. A gének önálló programcsomagként

Részletesebben

Az ellenanyagok orvosbiológiai. PhD kurzus 2011/2012 II. félév

Az ellenanyagok orvosbiológiai. PhD kurzus 2011/2012 II. félév Az ellenanyagok orvosbiológiai alkalmazása PhD kurzus 2011/2012 II. félév Ellenanyagok előállítása, tisztítása, jelölése, fragmentálása Monoklonális vs. poliklonális ellenanyagok Ellenanyagok előállítása

Részletesebben

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai

BIOMOLEKULÁK KÉMIÁJA. Novák-Nyitrai-Hazai BIOMOLEKULÁK KÉMIÁJA Novák-Nyitrai-Hazai A tankönyv elsısorban szerves kémiai szempontok alapján tárgyalja az élı szervezetek felépítésében és mőködésében kulcsfontosságú szerves vegyületeket. A tárgyalás-

Részletesebben

6. Zárványtestek feldolgozása

6. Zárványtestek feldolgozása 6. Zárványtestek feldolgozása... 1 6.1. A zárványtestek... 1 6.1.1. A zárványtestek kialakulása... 2 6.1.2. A feldolgozási technológia... 3 6.1.2.1. Sejtfeltárás... 3 6.1.2.2. Centrifugálás, tisztítás...

Részletesebben

A doktori értekezés tézisei. A növényi NRP fehérjék lehetséges szerepe a hiszton defoszforiláció szabályozásában, és a hőstressz válaszban.

A doktori értekezés tézisei. A növényi NRP fehérjék lehetséges szerepe a hiszton defoszforiláció szabályozásában, és a hőstressz válaszban. A doktori értekezés tézisei A növényi NRP fehérjék lehetséges szerepe a hiszton defoszforiláció szabályozásában, és a hőstressz válaszban. Bíró Judit Témavezető: Dr. Fehér Attila Magyar Tudományos Akadémia

Részletesebben

Reakciókinetika és katalízis

Reakciókinetika és katalízis Reakciókinetika és katalízis 14. előadás: Enzimkatalízis 1/24 Alapfogalmak Enzim: Olyan egyszerű vagy összetett fehérjék, amelyek az élő szervezetekben végbemenő reakciók katalizátorai. Szubsztrát: A reakcióban

Részletesebben

Immunológia I. 2. előadás. Kacskovics Imre (imre.kacskovics@ttk.elte.hu)

Immunológia I. 2. előadás. Kacskovics Imre (imre.kacskovics@ttk.elte.hu) Immunológia I. 2. előadás Kacskovics Imre (imre.kacskovics@ttk.elte.hu) Az immunválasz kialakulása A veleszületett és az adaptív immunválasz összefonódása A veleszületett immunválasz mechanizmusai A veleszületett

Részletesebben

3. Aminosavak gyártása

3. Aminosavak gyártása 3. Aminosavak gyártása Előállításuk Fehérje-hidrolizátumokból: cisztein, leucin, aszparaginsav, tirozin, glutaminsav Kémiai szintézissel: metionin, glicin, alanin, triptofán (reszolválás szükséges) Biotechnológiai

Részletesebben

A jelenleg jóváhagyott technológiák 95%-a ezt a három gazdaszervezetet használja: E. coli S. cerevisiae Chinese Hamster Ovary, CHO

A jelenleg jóváhagyott technológiák 95%-a ezt a három gazdaszervezetet használja: E. coli S. cerevisiae Chinese Hamster Ovary, CHO REKOMBINÁNS FEHÉRJÉK GYÁRTÁSA olyan fehérjéket állítunk elő biotechnológiai úton, amelyeknek kódoló DNS-ét mesterségesen, célzott génmanipulációval vittük be a termelő organizmusba. A gyártás megtervezésénél

Részletesebben

Zárójelentés. Állati rotavírusok összehasonlító genomvizsgálata. c. OTKA kutatási programról. Bányai Krisztián (MTA ATK ÁOTI)

Zárójelentés. Állati rotavírusok összehasonlító genomvizsgálata. c. OTKA kutatási programról. Bányai Krisztián (MTA ATK ÁOTI) Zárójelentés Állati rotavírusok összehasonlító genomvizsgálata c. OTKA kutatási programról Bányai Krisztián (MTA ATK ÁOTI) 2012 1 Az Állati rotavírusok összehasonlító genomvizsgálata c. programban azt

Részletesebben

A kvantitatív PCR alkalmazhatósága a fertőző bronchitis vakcinák hatékonysági vizsgálatában. Derzsy Napok, Sárvár, 2011 Június 2-3.

A kvantitatív PCR alkalmazhatósága a fertőző bronchitis vakcinák hatékonysági vizsgálatában. Derzsy Napok, Sárvár, 2011 Június 2-3. A kvantitatív PCR alkalmazhatósága a fertőző bronchitis vakcinák hatékonysági vizsgálatában Pénzes Zoltán PhD, Soós Pál PhD, Nógrády Noémi PhD, Varga Mária, Jorge Chacón PhD, Zolnai Anna PhD, Nagy Zoltán

Részletesebben

A rák, mint genetikai betegség

A rák, mint genetikai betegség A rák, mint genetikai betegség Diák: Ferencz Arnold-Béla la Felkész szítı tanár: József J Éva Bolyai Farkas Elméleti leti LíceumL Mi is a rák r tulajdonképpen? A rák r k egy olyan betegség g ahol sejt

Részletesebben

BIOTECHNOLÓGIÁK EGYÉB IPARÁGAKBAN. Pókselyemfehérjék előállítása dohányban és burgonyában

BIOTECHNOLÓGIÁK EGYÉB IPARÁGAKBAN. Pókselyemfehérjék előállítása dohányban és burgonyában BIOTECHNOLÓGIÁK EGYÉB IPARÁGAKBAN Pókselyemfehérjék előállítása dohányban és burgonyában Tárgyszavak: selyemfehérje; transzgénikus növény; szintetikus pókselyem; selyemfehérjegén. A Nephila clavipes pók

Részletesebben

Vezikuláris transzport

Vezikuláris transzport Molekuláris Sejtbiológia Vezikuláris transzport Dr. habil KŐHIDAI László Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet 2005. november 3. Intracelluláris vezikul uláris transzport Kommunikáció

Részletesebben

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Dr. Czeglédi Levente Dr. Béri Béla Kutatás-fejlesztés támogatása a megújuló energiaforrások és agrár

Részletesebben

Ph.D. értekezés tézisei. Dürgő Hajnalka. Témavezető: Dr. Medzihradszky-Fölkl Katalin. Biológia Doktori Iskola. MTA SZBK Biokémiai Intézet SZTE TTIK

Ph.D. értekezés tézisei. Dürgő Hajnalka. Témavezető: Dr. Medzihradszky-Fölkl Katalin. Biológia Doktori Iskola. MTA SZBK Biokémiai Intézet SZTE TTIK Gümő-specifikus NCR peptidek azonosítása, vad és mutáns Medicago truncatula gyökérgümők összehasonlító fehérjeanalízise, és az NCR247 lehetséges bakteriális interakciós partnereinek felderítése Ph.D. értekezés

Részletesebben

A biokémia alapjai. Typotex Kiadó. Wunderlich Lívius Szarka András

A biokémia alapjai. Typotex Kiadó. Wunderlich Lívius Szarka András A biokémia alapjai Wunderlich Lívius Szarka András Összefoglaló: A jegyzet elsősorban egészségügyi mérnök MSc. hallgatók részére íródott, de hasznos segítség lehet biomérnök és vegyészmérnök hallgatók

Részletesebben