Méret: px
Mutatás kezdődik a ... oldaltól:

Download "(11) Lajstromszám: E 006 779 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA"


1 !HU T2! (19) HU (11) Lajstromszám: E (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E (22) A bejelentés napja: (96) Az európai bejelentés bejelentési száma: EP (97) Az európai bejelentés közzétételi adatai: EP A (97) Az európai szabadalom megadásának meghirdetési adatai: EP B (1) Int. Cl.: C07K 14/00 (06.01) A61K 38/00 (06.01) A61K 39/00 (06.01) C07K 16/00 (06.01) C07K 16/46 (06.01) C07K 19/00 (06.01) A61K 39/39 (06.01) C12N /00 (06.01) C12N 1/00 (06.01) A61P 7/06 (06.01) C07K 14/0 (06.01) (87) A nemzetközi közzétételi adatok: WO PCT/US 04/ () Elsõbbségi adatok: P US (72) Feltalálók: HEAVNER, George, Malvern, Pennsylvania 19 (US); KNIGHT, David, M., Berwyn, Pennsylvania (US); SCALLON, Bernard, Collegeville, Pennsylvania (US); GHRAYEB, John, Downingtown, Pennsylvania 293 (US); NESSPOR, Thomas, C., Collegeville, PA (US); HUANG, Chichi, Berwyn, Pennsylvania (US) (73) Jogosult: Centocor Ortho Biotech, Inc., Horsham, PA (US) (74) Képviselõ: dr. Pethõ Árpád, DANUBIA Szabadalmi és Jogi Iroda Kft., Budapest (4) Emberi eritropoietinutánzó kapocsmag utánzóanyagok ( hinge core mimetibodyk), készítmények, eljárások és alkalmazások (7) Kivonat HU T2 A leírás terjedelme 38 oldal A találmány tárgyát emlõs-epo-utánzó kapocsmag ( hinge core ) utánzóanyagok ( mimetibodyk ), EPOutánzó kapocsmag utánzóanyagokat kódoló és komplementer nukleinsavak, gazdasejtek, valamint ezek elõállítására és alkalmazására szolgáló eljárások képezik, ideértve a terápiás kiszereléseket és a gyógyászati alkalmazásokat is. Az európai szabadalom ellen, megadásának az Európai Szabadalmi Közlönyben való meghirdetésétõl számított kilenc hónapon belül, felszólalást lehet benyújtani az Európai Szabadalmi Hivatalnál. (Európai Szabadalmi Egyezmény 99. cikk (1)) A fordítást a szabadalmas az 199. évi XXXIII. törvény 84/H. -a szerint nyújtotta be. A fordítás tartalmi helyességét a Magyar Szabadalmi Hivatal nem vizsgálta.

2 A találmány leírása A találmány háttere A találmány tárgyköre A találmány tárgyát emlõs-epo-utánzó kapocsmag ( hinge core ) utánzóanyagok ( mimetibodyk ), EPOutánzó kapocsmag utánzóanyagokat kódoló és komplementer nukleinsavak, gazdasejtek, valamint ezek elõállítására és alkalmazására szolgáló eljárások képezik, ideértve a terápiás kiszereléseket és a gyógyászati alkalmazásokat is. A vonatkozó technika állása A rekombináns proteinek a gyógyászati ágensek egyre fontosabb osztályát képezik. Az ilyen rekombináns terápiás ágensek elõrelépést hoztak a proteinek kiszerelése és kémiai módosítása terén. Ezek a módosítások potenciálisan fokozzák a terápiás proteinek terápiás alkalmazhatóságát, például a felezési idõ megnövelésével (például a proteolitikus enzimek hozzáférésének blokkolásával), biológiai aktivitásuk fokozásával, vagy nemkívánatos mellékhatásaik csökkentésével. Ilyen módosítás például a receptorproteinekkel fuzionált immunglobulinfragmensek, például az enteracept alkalmazása. Hosszabb felezési idõ elérése, vagy például Fc¹receptor-kötés, A¹protein-kötés vagy komplementkötés biztosítása érdekében is szerkesztettek az Fc domén alkalmazásával terápiás proteineket. Az emlõsök vérképzõ rendszerének egyik specifikus, létfontosságú szerepe az állat testét alkotó különféle szövetekhez oxigént szállító eritrociták, más néven vörösvérsejtek képzése. Az eritrociták képzésének folyamata (az eritropoézis) az eritrociták pusztulásának ellensúlyozása érdekében az állat egész életében folyamatosan zajlik. A vörösvértestek élettartama viszonylag rövid, jellemzõen 0 1 nap közötti. Az eritropoézis precízen szabályozott élettani mechanizmus, amelyben a szövetek megfelelõ oxigénellátásához elegendõ, de a vérkeringést nem akadályozó számú eritrocita képzésére kerül sor. Ma már ismert, hogy az eritropoézist elsõdlegesen egy polipeptid, az eritropoietin (EPO) nevû savas glikoprotein szabályozza. Az eritropoietin egy emlõs kromoszómán található egy kópiájú gén expressziójának eredményeként termelõdik. A rekombináns emberi EPO ( rhuepo ) aminosavszekvenciája alapvetõen megegyezik az emberi vizeletbõl nyert EPO aminosavszekvenciájával. A rhuepo glikozilációja azonban eltér a vizelet eredetû EPO és az emberi szérumeredetû EPO esetében tapasztalttól. Egészséges emlõs vérplazmája nagyon alacsony koncentrációban tartalmaz EPO¹t, mivel a meglévõ számú keringõ eritrocita képes biztosítani a szövetek megfelelõ oxigénellátását. A plazmában jelen lévõ EPO az elöregedésük miatt elvesztett eritrociták pótlásához szükséges vörösvérsejtek képzõdését stimulálja. Az EPO-termelés fokozódik hipoxiás állapotokban, amelyeknél a test szöveteinek oxigénellátása a megfelelõ szöveti vérellátás ellenére az élettani szint alá csökken. Hipoxia alakulhat ki vérzés, sugárzás okozta vörösvértest-pusztulás, különféle anémiák, nagy tengerszint feletti magasság, vagy hosszabb ideig tartó eszméletvesztés miatt. Ezzel szemben, ha a keringõ vörösvérsejtek száma meghaladja a normál szöveti oxigénellátáshoz szükséges mennyiséget, az EPO termelése csökken. Bizonyos megbetegedések rendellenes eritropoézissel járnak. A rekombináns emberi EPO¹t (rhuepo¹t) számos országban terápiás céllal alkalmazzák. Az Amerikai Egyesült Államokban az Egyesült Államok Élelmiszer- és Gyógyszer-engedélyezési Hivatala (U. S. Food and Drug Administration, FDA) jóváhagyta az rhuepo végállapotú vesebetegséggel kapcsolatos anémia kezelésére történõ alkalmazását. Az ezen betegség kezelése érdekében hemodialízisen átesõ betegek jellemzõen súlyos fokú anémiában szenvednek, amit a vörösvérsejtek dialíziskezelés okozta károsodása és korai pusztulása idéz elõ. Az EPO más típusú anémiák kezelésére is eredményesen alkalmazható. Így például a kemoterápia okozta anémia, a mielodiszplázia okozta anémia, a különféle veleszületett megbetegedésekkel kapcsolatos anémiák, az AIDShez kapcsolódó anémia, a koraszülöttséghez kapcsolódó anémia mind kezelhetõk EPO-val. Mindemellett az EPO egyéb területeken is szerepet kaphat, így például csontvelõ-átültetésen átesett páciensekben elõsegítheti a normál hematokritérték gyorsabb elérését, igénybe vehetõ autológ vértranszfúzióra készülõ betegekben, valamint vastelítettségi rendellenességben szenvedõ páciensekben. Az eritropoietin (EPO) 16 aminosavból és négy szénhidrátláncból álló glikoprotein, amely az eritrocita prekurzorsejtek felületén lévõ specifikus receptorhoz kapcsolódva az eritropoézis elsõdleges szabályozójaként mûködik. A kötõdés hatására a prekurzorsejtek proliferálódnak és érett vörösvérsejtekké differenciálódnak. Az eritropoietinreceptor 484 aminosavból álló glikoprotein, amely nagy affinitással kötõdik az eritropoietinhez. Az eritropoietinreceptor esetében a ligandum indukálta homodimerizáció lehet az aktiválódást irányító egyik kulcsfontosságú esemény. Az eritropoietin viszonylag rövid felezési idõvel bír. Az intravénásan beadott eritropoietin elsõ fajú kinetikát követve eliminálódik, a keringõ eritropoietin felezési ideje idült vesebeteg páciensek esetében 3¹4 óra közötti. A terápiás dózisintervallum legalább 24 órán keresztül kimutatható plazma-eritropoietinszintet biztosít. Az eritropoietin szubkután beadását követõen szérumkoncentrációja 24 órán belül éri el a csúcsértéket majd lassan csökken. Random fág diszpléj peptidkönyvtárak eritropoietinreceptorral szembeni affinitás szempontjából történõ szkrínelésével több kutatócsoport is kisméretû eritropoietin peptidomimetikumokat azonosított. Ezek a szekvenciák nem mutatnak homológiát az eritropoietinnel. Funkcionális vizsgálati eljárásokban ezen peptidek közül több is aktivitást mutatott, amely azonban a rekombináns eritropoietinének csupán egy százezred része volt. Bár számos kísérlet történt ezen peptidek hatáserõsségének kovelens dimerek vagy multimerek ki- 2

3 alakításával történõ fokozására, ezek a vegyületek moláris egyenértéken számítva még mindig ezerszer tízezerszer kevésbé aktívak, mint az eritropoietin, továbbá nagyon rövid felezési idõvel rendelkeznek, ami nem teszi lehetõvé terápiás felhasználásukat. Mindezek alapján igény mutatkozik terápiás EPOproteinek továbbfejlesztett és/vagy módosított változatai iránt, amelyekkel kikerülhetõk az említett és a szakember számára ismert egyéb problémák. A találmány szerinti megoldás összefoglalása A találmány tárgyát 2. igénypont szerinti emberi EPO-utánzó kapocsmag utánzóanyag, valamint az 1. igénypont szerinti EPO-utánzó kapocsmag utánzóanyag készítmény, valamint a igénypontok szerinti kódoló- vagy komplementer nukleinsav, vektorok, gazdasejtek, készítmények, a utánzóanyag elõállítására szolgáló eljárások, valamint annak gyógyászati alkalmazásai képezik. A WO 00/24782 számú nemzetközi közzétételi irat Fc domén biológiailag aktív peptiddel történt fúzióját mutatja be. A biológiailag aktív peptid az EMP¹1 jelû EPO-utánzó peptid is lehet (lásd D2, SEQ ID NOS.: 17, 1. oldal, 1. sor). Az US 03/ számú amerikai egyesült államokbeli szabadalmi irat emberi EPO-utánzó HuEPO- L-vFc ( 1, 2 vagy 4 izotípusú) fúziós proteineket mutat be (lásd [0002] bekezdés, valamint 2C. ábra). Mindezeknek megfelelõen egy ellenanyag vagy immunglobulinszerkezet vagy ¹funkció legalább egy részét utánzó, saját tulajdonságokkal és funkciókkal rendelkezõ találmány szerinti EPO-utánzó kapocsmag utánzóanyag velejáró vagy szerzett in vitro, in vivo vagy in situ tulajdonságokkal vagy aktivitással rendelkezõ terápiás peptidet biztosít. Egy szempontból a találmány tárgyát a specifikus utánzóanyagot kódoló polinukleotidot tartalmazó vagy azzal komplementer izolált nukleinsavmolekulák képezik. A találmány tárgyát képezik továbbá a utánzóanyag nukleinsavmolekulákat tartalmazó rekombináns vektorok, az ilyen nukleinsavakat és/vagy rekombináns vektorokat tartalmazó gazdasejtek, valamint az EPOutánzó kapocsmag utánzóanyag nukleinsavak, vektorok és/vagy gazdasejtek elõállítására és/vagy alkalmazására szolgáló eljárások. Az EPO-utánzó kapocsmag utánzóanyag a utánzóanyag P¹részének legalább egy ligandumhoz történõ kötõdését utánozza, vagy legalább egy protein, alegység, fragmens, rész vagy ezek tetszõleges kombinációjának legalább egy biológiai aktivitásával rendelkezik. A találmány tárgyát képezi továbbá az izolált EPOutánzó kapocsmag utánzóanyag, ahol az EPO-utánzó kapocsmag utánzóanyag legalább egy biológiai aktivitással bír, amilyen például, de nem kizárólag az I. képlet P¹részletének megfelelõ legalább egy bioaktív peptid vagy polipeptid ismert biológiai aktivitása. Egy EPOutánzó kapocsmag utánzóanyag ez alapján ismert eljárásokkal megfelelõ aktivitás, így például legalább egy proteinre vagy annak fragmensére irányuló neutralizáló aktivitás megléte szempontjából szkrínelhetõ A találmány tárgyát képezi továbbá a következõ összetevõkbõl álló legalább egy készítmény (a) találmány szerinti izolált EPO-utánzó kapocsmag utánzóanyagot kódoló nukleinsav és/vagy EPO-utánzó kapocsmag utánzóanyag; (b) megfelelõ vivõanyag vagy hígító. A vivõanyag vagy hígító adott esetben ismert eljárások szerint gyógyászati szempontból elfogadható lehet. A készítmény adott esetben tartalmazhat továbbá legalább egy további vegyületet, proteint vagy készítményt. A találmány tárgyát képezi továbbá az EPO-utánzó kapocsmag utánzóanyag gazdasejtben történõ expresszálására szolgáló legalább egy eljárás, amely során a gazdasejt kimutatható és/vagy kinyerhetõ mennyiségû EPO-utánzó kapocsmag utánzóanyag expresszálódását biztosító, találmány szerinti vagy szakember számára ismert körülmények közötti tenyésztésére kerül sor. A találmány tárgyát képezi továbbá a 8. igénypont szerinti, ember-epo-ligandummal kapcsolatos állapotának kezelése érdekében beadandó, EPO-utánzó kapocsmag utánzóanyag vagy azt tartalmazó készítmény. Az EPO-utánzó kapocsmag utánzóanyag adott esetben a következõ tulajdonságok legalább egyikével rendelkezik: legalább 9 M, legalább M, legalább 11 M, vagy legalább 12 M affinitással képes proteint megkötni; lényeges mértékben neutralizálja legalább egy protein vagy annak részlete legalább egy aktivitását. A találmány tárgyát képezi továbbá az izolált emberi EPO-utánzó kapocsmag utánzóanyagot kódoló izolált nukleinsav; az izolált nukleinsavat tartalmazó izolált nukleinsavvektor, és/vagy az izolált nukleinsavat magában foglaló prokarióta vagy eukarióta gazdasejt. A gazdasejt adott esetben a következõk bármelyike lehet: COS-1, COS-7, HEK293, BHK21, CHO¹, BSC-1, Hep G2, 63, SP2/0, 293, HeLa¹, mielóma- vagy limfómasejt, vagy ezek bármely származéka, halhatatlanná tett (immortalizált) vagy transzformált alakja. A találmány tárgyát képezi továbbá az EPO-utánzó kapocsmag utánzóanyag elõállítására szolgáló eljárás, amely során az EPO-utánzó kapocsmag utánzóanyagot kódoló nukleinsav in vitro, in vivo vagy in situ transzlációjára kerül sor olyan körülmények között, amelyek kimutatható vagy kinyerhetõ mennyiségû EPO-utánzó kapocsmag utánzóanyag expresszálódását teszik lehetõvé. A találmány tárgyát képezi továbbá az izolált emberi EPO-utánzó kapocsmag utánzóanyagot és legalább egy, gyógyászati szempontból elfogadható vivõanyagot vagy hígítót tartalmazó készítmény. A készítmény adott esetben a következõ vegyületek vagy proteinek legalább egyikének hatékony mennyiségét tartalmazhatja: kimutatható jelzõanyag vagy riporter, antiinfektív drog, szív-érrendszeri (CV) drog, központi idegrendszeri (CNS) drog, autonóm idegrendszeri (ANS) drog, légzõszervi drog, gyomor-bélrendszeri drog, hormonális drog, folyadék- vagy elektrolit-egyensúlyra ható drog, hematológiai drog, daganatellenes drog, immunmoduláló drog, szem¹, fül- vagy orrkezelésre szolgáló drog, helyi kezelésre szolgáló drog, táplálkozásra ható drog, TNF-antagonista, reumaellenes szer, izomrela- 3

4 xáns, narkotikum, nem szteroid gyulladáscsökkentõ, fájdalomcsillapító, érzéstelenítõ, szedatívum, helyi érzéstelenítõ, neuromuszkuláris blokkoló, antimikrobiális szer, övsömörellenes szer, kortikoszteroid, anabolikus szteroid, eritropoietin, immunizáció, immunglobulin, immunszuppresszáns, növekedési hormon, hormonhelyettesítõ drog, radiofarmakon, antidepresszáns, antipszichotikum, stimuláns, asztmaellenes készítmény, béta-antagonista, inhalációs szteroid, adrenalin vagy analógja, citokin, vagy citokinantagonista. A találmány tárgyát képezi továbbá sejt, szövet, szerv vagy állat megbetegedésének kezelésére szolgáló izolált emberi EPO-utánzó kapocsmag utánzóanyag, amely kezelés során (a) a találmány szerinti izolált emberi EPO-utánzó kapocsmag utánzóanyag hatékony mennyiségét tartalmazó készítménnyel inkubáljuk vagy kezeljük a sejtet, szövetet, szervet vagy állatot. Adott esetben a készítményben lévõ hatékony mennyiség 0,001 0 mg/kg sejt, szövet, szerv vagy állat. A utánzóanyag adott esetben a következõ beadási módok legalább egyikével inkubálható vagy adható be: parenterális, szubkután, intramuszkuláris, intravénás, intraartikuláris, intrabronchialis, intraabdominalis, intrakapszuláris, porcba történõ, intrakavitáris, intraceliális, intracerebelláris, intracerebroventrikuláris, vastagbélbe történõ, intracervikális, intragasztrikus, intrahepatikus, intramiokardiális, intraoszteális, medencébe történõ, intraperikardiális, intraperitoneális, intrapleurális, intraprosztatikus, intrapulmonáris, intrarektális, intrarenális, intraretinális, intraspinális, intraszinoviális, intratorakális, intrauterin, intravezikális módon, bóluszban, vaginálisan, rektálisan, szublingválisan, intranazálisan vagy transzdermálisan. A utánzóanyag adott esetben az (a) inkubálás vagy beadás elõtt, azzal egy idõben vagy azt követõen adott, a következõk közül legalább egy vegyületet vagy proteint tartalmazó készítmény beadásával együtt is alkalmazható: kimutatható jelzõanyag vagy riporter, antiinfektív drog, kardiovaszkuláris (CV) drog, központi idegrendszeri (CNS) drog, autonóm idegrendszeri (ANS) drog, légzõszervi drog, gasztrointesztinális (GI) drog, hormonális drog, folyadék- vagy elektrolitegyensúlyra ható drog, hematológiai drog, daganatellenes drog, immunmoduláló drog, szem¹, fül- vagy orrkezelésre szolgáló drog, helyi kezelésre szolgáló drog, táplálkozásra ható drog, TNF-antagonista, reumaellenes szer, izomrelaxáns, narkotikum, nem szteroid gyulladáscsökkentõ, fájdalomcsillapító, érzéstelenítõ, szedatívum, helyi érzéstelenítõ, neuromuszkuláris blokkoló, antimikrobiális szer, övsömörellenes szer, kortikoszteroid, anabolikus szteroid, eritropoietin, immunizáció, immunglobulin, immunszuppresszáns, növekedési hormon, hormonhelyettesítõ drog, radiofarmakon, antidepresszáns, antipszichotikum, stimuláns, asztmaellenes készítmény, béta-antagonista, inhalációs szteroid, adrenalin vagy analógja, citokin, vagy citokinantagonista A találmány szerinti megoldás leírása A találmány tárgyát a 2. igénypontban meghatározott izolált, rekombináns és/vagy szintetikus utánzóanyag, valamint az EPO-utánzó kapocsmag utánzóanyagot kódoló legalább egy polinukleotidot tartalmazó készítmények és kódoló nukleinsavmolekulák képezik. Jelen leírás szerinti értelemben az EPO-utánzó kapocsmag utánzóanyag legalább egy protein legalább egy ligandumkötését vagy legalább egy biológiai aktivitását, így például többek között, de nem kizárólag az 1. azonosító számú szekvenciák (SEQ ID NO. 1.) bármelyikén megadott protein in vitro, in situ és/vagy elõnyösen in vivo ligandumkötését vagy aktivitását utánozza, hordozza vagy stimulálja. Például az EPO-utánzó kapocsmag utánzóanyag képes megkötni legalább egy proteinligandumot, és legalább egy proteinligandum, receptor, oldható receptor stb. lehet. A találmány szerinti megoldás szempontjából megfelelõ EPO-utánzó kapocsmag utánzóanyag képes modulálni, fokozni, módosítani, aktiválni legalább egy proteinreceptor jelátadást vagy egyéb mérhetõ vagy kimutatható aktivitást. A találmány szerinti utánzóanyag proteinligandumokhoz vagy receptorokhoz történõ megfelelõ affinitású kötõdéssel és adott esetben elõnyösen alacsony toxicitással jellemezhetõ. Közelebbrõl az EPO-utánzó kapocsmag utánzóanyag elõnyösen alacsony szintû immunogenitással rendelkezik. A találmány szerinti megoldásban alkalmazható utánzóanyag adott esetben jellemzõen alacsony toxicitás mellett, hosszú ideig tartó kezelésre alkalmazható, és megfelelõ vagy kiváló mértékben enyhíti a páciensek tüneteit. Az elért terápiás eredményekhez a kismértékû immunogenitás és/vagy nagyfokú affinitás, valamint egyéb, közelebbrõl nem meghatározott tulajdonságok is hozzájárulhatnak. Kismértékû immunogenitás alatt azt értjük, hogy a kezelt páciensek kevesebb mint körülbelül 7%-ában, vagy kevesebb mint körülbelül 0, 4,,,, 1,, 9, 8, 7, 6,, 4, 3, 2 és/vagy 1%¹ában idéz elõ lényeges mértékû HAMA, HACA vagy HAHA válaszreakciót, vagy a kezelt páciensekben a titeremelkedés mértéke alacsony (dupla antigénes enzim immunvizsgálati eljárásban kevesebb mint körülbelül 0, elõnyösen kevesebb mint körülbelül 0) [lásd például Elliott és munkatársai, Lancet 344: (1994)]. Alkalmazás A találmány szerinti izolált nukleinsavak az EPOutánzó kapocsmag utánzóanyag elõállítására vehetõk igénybe, amely sejtben, szövetben, szervben vagy állatban (beleértve az emlõsöket és az embert) a következõk közül legalább egy proteinnel kapcsolatos állapot, például többek között egy immunológiai rendellenesség CEN039PCT vagy betegség, szív-érrendszeri rendellenesség vagy betegség, egy fertõzõ, malignus és/vagy neurológiai rendellenesség vagy betegség, anémia, immun/autoimmun; és/vagy rákos/fertõzõ, valamint további ismert vagy meghatározott, proteinnel kapcsolatos állapot módosítására, kezelésére, enyhítésére, elõfordulásának megakadályozására vagy tüneteinek csökkentésére alkalmazható. A utánzóanyag-készítmény vagy az EPO-utánzó kapocsmag utánzóanyagot tartalmazó gyógyászati ké- 4

5 szítmény hatékony mennyiségben adagolható az ilyen módosítást, kezelést, enyhítést, megelõzést vagy tünet¹, hatás- vagy mechanizmuscsökkentést igénylõ sejt, szövet, szerv, állat vagy páciens részére. Hatékony lehet a körülbelül 0,0001 és 00 mg/kg közötti mennyiség egy vagy több alkalommal beadva, vagy a 0, g/ml közötti szérumkoncentráció eléréséhez szükséges mennyiség egy vagy több alkalommal beadva, vagy az ezek közötti bármely hatékony érték vagy tartomány, amely meghatározására az itt leírt, vagy a releváns szakirodalomból ismert eljárások alkalmazhatók. Hivatkozások A jelen leírásban hivatkozott közlemények és szabadalmak a találmány szerinti leírás idõpontjában aktuális tudományos ismereteket tükrözik és/vagy bemutatják és elõsegítik a találmány szerinti megoldás megvalósítását. Publikáció alatt bármely tudományos vagy szabadalmi publikációt, vagy bármely, többek között rögzített, elektronikus vagy nyomtatott média formátumban elérhetõ egyéb információt értünk. Idetartoznak a következõ publikációk: Ausubel és munkatársai, szerk., Current Protocols in Molecular Biology, John Wiley & Sons, Inc., NY, NY ( ); Sambrook és munkatársai, Molecular Cloning: A Laboratory Manual, 2. kiadás, Cold Spring Harbor, NY (1989); Harlow és Lane, Antibodies, a Laboratory Manual, Cold Spring Harbor, NY (1989); Colligan és munkatársai, szerk., Current Protocols in Immunology, John Wiley & Sons, Inc., NY ( ); Colligan és munkatársai, Current Protocols in Protein Science, John Wiley & Sons, NY, NY, ( ). A találmány szerinti utánzóanyag ismert proteinekkel összehasonlítva legalább egy megfelelõ tulajdonságot biztosít, ilyen többek között, de nem kizárólag a következõk legalább egyike: megnövelt felezési idõ, fokozott aktivitás, specifikusabb aktivitás, fokozott aviditás, megnövekedett vagy csökkent off rate, szelektált vagy megfelelõbb aktivitás, kisebb mértékû immunogenitás, legalább egy kívánatos terápiás hatás fokozott minõsége vagy idõtartama, kevesebb mellékhatás stb. A találmány egy elõnyös megvalósítási módjában a találmány szerinti EPO-utánzó kapocsmag utánzóanyagot legalább egy sejtvonal, kevert sejtvonal, immortalizált sejt vagy immortalizált és/vagy tenyésztett sejtek klonális populációja termeli. A fehérjetermelõ, immortalizált sejtek elõállítására megfelelõ eljárások vehetõk igénybe. Az EPO-utánzó kapocsmag utánzóanyag elõállítására elõnyösen legalább egy funkcionálisan átrendezett, vagy funkcionális átrendezõdésre alkalmas, továbbá a találmány szerinti utánzóanyag szerkezetét tartalmazó emberi immunglobulinlokuszból származó, vagy ahhoz alapvetõen hasonló DNS¹t tartalmazó vektor vagy nukleinsav alkalmazásával kerül sor. A funkcionálisan átrendezett kifejezés immunglobulin lokuszból származó, V(D)J rekombináción átesett, így immunglobulinláncot (például nehézláncot), vagy annak tetszõleges részletét kódoló nukleinsavszegmenst jelöl. Funkcionálisan átrendezett immunglobulingén megfelelõ eljárásokkal, így például nukleotidszekvenálással, hibridizációval (például Southern-blot¹, Northern-blot-módszerrel), a génszegmensek közötti kódoló kapcsolódási pontokhoz tapadó próbákkal, immunglobulingének enzimatikus amplifikációjával (például polimeráz-láncreakcióval) a génszegmensek közötti kódoló kapcsolódási pontokhoz tapadó láncindítókkal közvetlenül vagy közvetett módon azonosítható. Megfelelõ eljárásokkal az is megállapítható, hogy egy sejt termeli¹e az egy meghatározott variábilis régiót, vagy egy adott szekvenciát (például legalább egy P¹szekvenciát) magában foglaló variábilis régiót tartalmazó EPO-utánzó kapocsmag utánzóanyagot. A találmány szerinti utánzóanyag elõállítható az EPO-utánzó kapocsmag utánzóanyagot kódoló nukleinsav alkalmazásával létrehozott, a utánzóanyagot a tejükben termelõ transzgenikus állatok vagy emlõsök, például kecskék, tehenek, lova, juhok stb. segítségével is. Ilyen állatok ellenanyag kódoló szekvenciákra alkalmazott ismert eljárások segítségével nyerhetõk. Lásd például, de nem kizárólag az ; az 84999; a ; az ; az ; az 6362; az 4489 számú és a hasonló amerikai egyesült államokbeli szabadalmi iratokat. A találmány szerinti utánzóanyag elõállítható továbbá legalább egy EPO-utánzó kapocsmag utánzóanyagot kódoló nukleinsav segítségével létrehozott transzgenikus növények és tenyésztett növényi sejtek (többek között, de nem kizárólag például dohány és kukorica) alkalmazásával, amelyek a növényi részekben vagy a belõlük tenyésztett sejtekben termelik az utánzóanyagokat. Nem korlátozó érvényû példaként megemlítendõ, hogy rekombináns proteineket expresszáló transzgenikus dohányleveleket sikeresen alkalmaztak nagy mennyiségû rekombináns protein elõállítására, például indukálható promoter segítségével. Lásd például Cramer és munkatársai, Curr. Top. Microbiol. Immunol. 2:9 118 (1999) és a benne foglalt hivatkozásokat. Transzgenikus kukoricát vagy gabonát igénybe vettek továbbá emlõsproteinek ipari mennyiségû expresszálására, amelyek a más rekombinánsrendszerekben elõállított, vagy természetes forrásokból kitisztított proteinekkel egyenrangú biológiai aktivitással rendelkeztek. Lásd például Hood és munkatársai, Adv. Exp. Med. Biol. 464: (1999) és a benne foglalt hivatkozásokat. Transzgenikus növényi magokból, például dohánymagból és burgonyagumóból nagy mennyiségben állítottak elõ ellenanyagokat, így ellenanyagfragmenseket, például szimpla láncú utánzóanyagokat (scfv s) is. Lásd például Conrad és munkatársai, Plant Mol. Biol. 38:1 9 (1998) és a benne foglalt hivatkozásokat. Mindezeknek megfelelõen a találmány szerinti utánzóanyag ismert eljárásokkal, transzgenikus növények alkalmazásával is elõállítható. Lásd továbbá például Fischer és munkatársai, Biotechnol. Apl. Biochem. :99 8 (Oct., 1999), Ma és munkatársai, Trends Biotechnol. 13:22 7 (199); Ma és munkatársai, Plant Physiol. 9:341 6 (199); White-

6 lam és munkatársai, Biochem. Soc. Trans. 22:9 944 (1994) és a bennük foglalt referenciákat. A találmány szerinti utánzóanyag széles affinitástartományban (K D ) képes emberi proteinligandumok megkötésére. A találmány egy elõnyös megvalósítási módjában a találmány szerinti emberi EPO-utánzó kapocsmag utánzóanyag adott esetben legalább egy proteinligandumot nagy affinitással képes megkötni. Például a találmány szerinti EPO-utánzó kapocsmag utánzóanyag adott esetben legalább egy proteinligandumot 7 M vagy alacsonyabb K D értékkel, elõnyösebben 0,1 9,9 (ideértve bármely köztes tartományt vagy értéket) 7, 8, 9,, 11, 12, vagy 13 M vagy alacsonyabb K D értékkel (beleértve bármely köztes értéket vagy tartományt) képes megkötni. Az EPO-utánzó kapocsmag utánzóanyag legalább egy proteinligandumra vonatkozó affinitása vagy aviditása bármely arra alkalmas, például ellenanyag-antigén kötõdés affinitásának vagy aviditásának megállapítására használt eljárással, kísérletesen állapítható meg. (Lásd például Berzofsky és munkatársai, Antibody-Antigen interactions In Fundamental Immunology, Paul, W. E., szerk., Raven Press; New York, NY (1984); Kuby, Janis Immunology, W. H. Freeman and Company; New York, NY (1992); illetve a bennük közzétett eljárásokat). Az EPO-utánzó kapocsmag utánzóanyag-ligandum kölcsönhatás megállapított affinitása különbözõ körülmények (például sókoncentráció, ph) között mérve eltérõ lehet. Emiatt az affinitás és egyéb ligandumkötési paraméterek (például K D,K n,k d ) meghatározását elõnyösen az EPO-utánzó kapocsmag utánzóanyag és ligandum standardizált oldataival, valamint például a leírásban szereplõ standardizált puffer alkalmazásával kell elvégezni. Nukleinsavmolekulák A jelen leírásban közölt információ, így például az 1. azonosító számú szekvenciák bármelyikén megadott egymást követõ aminosavak legalább 90 0%¹át, valamint egy ellenanyag legalább egy részét kódoló nukleotidszekvenciák ismeretében, ahol az említett szekvenciák (I) képletbe P szekvenciaként inszertálva találmány szerinti EPO-utánzó kapocsmag utánzóanyagot adnak, vagy az említett szekvenciák legalább egyikét tartalmazó deponált vektor ismeretében itt közzétett, vagy szakember számára ismert eljárásokkal elõállítható az EPOutánzó kapocsmag utánzóanyagot kódoló találmány szerinti nukleinsavmolekula. A találmány szerinti nukleinsav lehet RNS, így például mrns, hnrns, trns vagy bármely egyéb forma, vagy lehet DNS, így többek között, de nem kizárólag cdns, klónozással vagy szintetikus úton elõállított genomi DNS, vagy mindezek tetszõleges kombinációja. A DNS tripla szálú, dupla szálú, szimpla szálú, vagy ezek tetszõleges kombinációja lehet. A DNS vagy RNS legalább egy szálának tetszõleges része kódoló, más néven szensz szál lehet, vagy lehet nemkódoló, másnéven antiszensz szál. A találmány szerinti izolált nukleinsavmolekulák közé tartozhatnak nyitott leolvasási keretet (ORF¹et) és adott esetben egy vagy több intront tartalmazó nukleinsavmolekulák, az EPO-utánzó kapocsmag utánzóanyag kódolószekvenciáját tartalmazó nukleinsavmolekulák, valamint a fentiektõl lényegesen eltérõ nukleotidszekvenciát tartalmazó nukleinsavmolekulák, amelyek azonban a genetikai kód degeneráltságának köszönhetõen mégis a találmány szerinti vagy szakember számára ismert EPO-utánzó kapocsmag utánzóanyagot kódolják. A genetikai kód szakember számára természetesen jól ismert. Ennek megfelelõen gyakorlott szakember számára rutinfeladatnak számít a találmány szerinti EPO-utánzó kapocsmag utánzóanyagot kódoló degenerált nukleinsavvariánsok elõállítása (lásd például Ausubel és munkatársai, fentebb). Ezek a nukleinsavvariánsok is a találmány tárgyát képezik. Az EPO-utánzó kapocsmag utánzóanyagot kódoló nukleinsavat tartalmazó találmány szerinti nukleinsavmolekulák közé tartoznak többek között, de nem kizárólag a magát az EPO-utánzó kapocsmag utánzóanyag-fragmens aminosavszekvenciáját kódoló nukleinsavmolekulák, a teljes EPO-utánzó kapocsmag utánzóanyag kódolószekvenciáját tartalmazó nukleinsavmolekulák, az EPO-utánzó kapocsmag utánzóanyag kódolószekvenciáját további szekvenciákkal együtt, például legalább egy szignálvezetõ vagy fúziós peptid kódolószekvenciájával, az elõbbiekben említett további kódolószekvenciákkal vagy azok nélkül, például legalább egy intronnal, további nemkódoló szekvenciákkal, így többek között, de nem kizárólag nemkódoló és 3 szekvenciákkal, például a transzkripcióban, mrns-feldolgozásban szerepet játszó transzkriptált, nem transzlált szekvenciákkal, ideértve a szplájszing és poliadenilációs szignálokat (például riboszómakötés és mrns-stabilitás); valamint további, kiegészítõfunkciókat biztosító további aminosavakat kódoló szekvenciákkal együtt tartalmazó nukleinsavmolekulák. Ennek megfelelõen az EPO-utánzó kapocsmag utánzóanyagot kódoló szekvencia marker szekvenciához, például a fuzionált EPO-utánzó kapocsmag utánzóanyag kitisztítását elõsegítõ peptidet kódoló szekvenciához fuzionálható. Nukleinsavszerkesztés A találmány szerinti nukleinsavak szakember számára jól ismert módon elõállíthatók (a) rekombinánseljárásokkal, (b) szintetikustechnikákkal, (c) tisztítótechnikákkal vagy mindezek kombinációjával. A nukleinsavak egy találmány szerinti polinukleotid mellett kényelmi okokból tartalmazhatnak egyéb szekvenciákat is. Például a polinukleotid izolálásának elõsegítése érdekében a nukleinsavba egy vagy több endonukleáz restrikciós helyet tartalmazó többszörös klónozóhely inszertálható. Hasonlóképpen transzlálható szekvenciák inszertálásával elõsegíthetõ a transzlált, találmány szerinti polinukleotid izolálása. Például egy hexa-hisztidin markerszekvencia megkönnyíti a találmány szerinti proteinek tisztítását. A találmány szerinti nukleinsav a kódolószekvencia kivételével adott esetben a találmány szerinti polinukleotid klónozására és/vagy expresszió- 6

7 jára szolgáló vektor, adapter vagy kapcsolószekvencia (linker). Az említett klónozó- és/vagy expressziós szekvenciákhoz a klónozásban és/vagy expresszióban betöltött mûködésük optimalizálása, a polinukleotid izolálásának elõsegítése, vagy a polinukleotid sejtbe juttatásának javítása érdekében további szekvenciák adhatók. Szakember számára jól ismertek a klónozóvektorok, expressziós vektorok, adapterek, kapcsolószekvenciák alkalmazásának módjai. Lásd például Ausubel, fentebb; vagy Sambrook, fentebb. Nukleinsavszerkesztésre szolgáló rekombinánseljárások A találmány szerinti izolált nukleinsavkészítmények, például RNS, cdns, genomi DNS vagy ezek kombinációi biológiai forrásokból, képzett szakember számára ismert tetszõleges klónozómetódussal nyerhetõk ki. A találmány bizonyos megvalósítási módjaiban a találmány szerinti polinukleotidokhoz megfelelõ sztringensségû állapotok mellett szelektíven hibridizáló oligonukleotidpróbákat alkalmazunk a kívánt szekvencia cdns- vagy genomi DNS-könyvtárban történõ azonosítására. Az RNS-izolálás és a cdns és genomi könyvtár készítés átlagosan képzett szakember számára jól ismertek (lásd például Ausubel, fentebb; vagy Sambrook, fentebb). Nukleinsavszerkesztésre szolgáló szintetikus eljárások A találmány szerinti izolált nukleinsavak ismert eljárásokkal közvetlen kémiai szintézis útján is elõállíthatók (lásd például Ausubel és munkatársai, fentebb). A kémiai szintézis általában szimpla szálú oligonukleotidot eredményez, amely dupla szálú DNS¹sé alakítható például komplementer szekvenciával történõ hibridizációval, vagy a szimpla szálat templátként alkalmazva DNS-polimerázzal történõ polimerizálással. Szakember számára ismert, hogy bár kémiai szintézissel csak körülbelül 0 körüli bázisból álló DNS-szekvenciák állíthatók elõ, a rövid szekvenciák összekapcsolásával hosszabb szekvenciák is nyerhetõk. Rekombináns expressziós kazetták A találmány tárgyát képezik továbbá az egy találmány szerinti nukleinsavat magukban foglaló rekombináns expressziós kazetták. Egy találmány szerinti nukleinsavszekvencia, például a találmány szerinti EPOutánzó kapocsmag utánzóanyagot kódoló cdns vagy genomi szekvencia igénybevételével rekombináns expressziós kazetta szerkeszthetõ, amely legalább egy kívánt gazdasejtbe illeszthetõ. A rekombináns expressziós kazetta jellemzõen a polinukleotid adott gazdasejtben történõ transzkripcióját irányító transzkripciókezdést szabályozó szekvenciákhoz mûködõképesen kapcsolt formában tartalmaz egy találmány szerinti polinukleotidot. A találmány szerinti nukleinsavak expressziójának irányításához heterológ és nem heterológ (vagyis endogén) promoterek egyaránt igénybe vehetõk A találmány egyes megvalósítási módjaiban a találmány szerinti polinukleotid expressziójának fokozása vagy csökkentése érdekében egy nem heterológ alakú, találmány szerinti polinukleotid megfelelõ ( oldali, 3 oldali vagy intronbeli) pozíciójába promoter, enhenszer vagy egyéb szerepet betöltõ elemek juttathatók. Endogén promoterek módosíthatók például szakember számára ismert módon in vivo vagy in vitro mutációval, delécióval és/vagy szubsztitúcióval. Egy találmány szerinti polinukleotid kívánt esetben szensz vagy antiszensz irányultságban egyaránt expresszálható. A génexpresszió szensz vagy antiszensz irányultságban történõ szabályozása közvetlen hatással lehet a megfigyelhetõ jellemzõkre. A szuppresszió egy további formája a szensz szuppresszió. Szensz irányultságú nukleinsav bejuttatásával igazoltan hatékonyan blokkolható a célpont gének transzkripciója. Vektorok és gazdasejtek A találmány tárgyát képezik továbbá a találmány szerinti izolált nukleinsavmolekulákat tartalmazó vektorok, a rekombináns vektorokkal genetikailag módosított gazdasejtek, valamint az EPO-utánzó kapocsmag utánzóanyag szakember számára ismert rekombinánstechnikákkal történõ elõállítása (lásd például Sambrook és munkatársai, fentebb; Ausubel és munkatársai, fentebb). Gazdaszervezetben történõ szaporítás céljából a polinukleotidok adott esetben kiválasztást elõsegítõ markert tartalmazó vektorhoz csatolhatók. Egy plazmidvektor sejtbe juttatása általában megfelelõ ismert eljárásokkal, például elektroporációval vagy hasonló módon történhet, erre a célra alkalmas további eljárások a vektor precipitátumként, például kalcium-foszfátprecipitátumként, vagy töltött lipiddel képzett komplexben történõ alkalmazása. Ha a vektor vírus, megfelelõ csomagoló sejtvonal segítségével in vitro csomagolható, majd gazdasejtekbe transzdukálható. A DNS-inszertnek megfelelõ promoterhez mûködõképesen kapcsoltnak kell lennie. Az expressziós szerkezetek adott esetben legalább egy további helyet tartalmaznak transzkripciókezdés, ¹befejezés, valamint a transzkriptált régióban a transzláció érdekében riboszómakötõdés céljából. A szerkezetek által expresszált érett transzkriptumok kódolórésze elõnyösen a transzlálandó mrns elején transzlációs kezdõhelyet, végén elhelyezve pedig végkodont (például UAA, UGA vagy UAG) tartalmaz, emlõs- vagy eukarióta sejtben történõ expresszió esetén az UAA és az UAG alkalmazása az elõnyös. Az expressziósvektorok elõnyösen, de csak adott esetben legalább egy kiválasztást elõsegítõ markert tartalmaznak. Ilyen markerek többek között, de nem kizárólag a metotrexát (MTX), a dihidrofolátreduktáz (DHFR, ; ; ; ; és számú amerikai egyesült államokbeli szabadalmi iratok), az ampicillin, a neomicin (G418), a mikofenolsav vagy a glutaminszintetáz (GS, ; 7709 és számú amerikai egyesült államokbeli szabadalmi iratok) eukarióta sejttenyé- 7

8 1 4 0 szet esetében, valamint a tetraciklin- vagy ampicillinrezisztencia-gének E. coli és más baktériumok vagy prokarióták esetében. Szakember számára ismertek a fentiekben említett gazdasejteknek megfelelõ tápközegek és tenyésztési körülmények. A megfelelõ vektorok gyakorlott szakember számára jól ismertek. Vektorszerkezet gazdasejtbe juttatására alkalmas a kalciumfoszfát-transzfekció, a DEAE-dextrán közvetített transzfekció, a kationos lipid közvetített transzfekció, az elektroporáció, a transzdukció, a fertõzés vagy egyéb ismert eljárás. Ezen eljárások leírása megtalálható a szakirodalomban, lásd például Sambrook, fentebb, 1 4. és fejezet; Ausubel, fentebb, 1., 9., 13., 1. és 16. fejezet. A találmány szerinti EPO-utánzó kapocsmag utánzóanyag módosított alakban, így például fúziós proteinként is expresszálható, és nem csupán szekréciós szignálokat, hanem további heterológ funkcionális régiókat is tartalmazhat. Például gazdasejtbeli perzisztencia és a tisztítás, vagy a késõbbi kezelés és tárolás alatti stabilitás elérése érdekében további, elsõsorban töltéssel rendelkezõ aminosavakból álló régió adható egy EPO-utánzó kapocsmag utánzóanyag N¹terminálisához, annak meghatározott részéhez vagy variánsához. A tisztítás elõsegítése érdekében a találmány szerinti EPO-utánzó kapocsmag utánzóanyaghoz peptidgyökök is adhatók. Ezek a régiók az EPO-utánzó kapocsmag utánzóanyag végleges elkészítése elõtt eltávolíthatók. Az erre vonatkozó eljárások számos standard laboratóriumi kézikönyvben megtalálhatók, lásd például Sambrook, fentebb, és fejezetek; Ausubel, fentebb, 16., 17. és 18. fejezet. Átlagosan képzett szakember megfelelõ ismeretekkel rendelkezik a találmány szerinti proteint kódoló nukleinsav expressziójára rendelkezésre álló számos expressziós rendszerrel kapcsolatban. A utánzóanyag elõállítására alkalmas sejttenyészetek jellemzõ képviselõi az emlõssejtek. Az emlõseredetû sejtrendszerek a legtöbb esetben egyrétegû sejttenyészetek, bár emlõssejt-szuszpenziók vagy bioreaktorok szintén igénybe vehetõk. Intakt glikozilált proteinek expresszálására alkalmas számos gazdasejtvonalat kialakítottak már, ilyenek például a COS¹1 (például ATCC CRL 1), a COS¹7 (például ATCC CRL-161), a HEK293, a BHK21 (például ATCC CRL¹), a CHO (például ATCC CRL 16, DG¹44) és a BSC¹1 (például ATCC CRL¹26) sejtvonal, a hepg2 sejtek, a P3X63Ag8.63, SP2/0¹Ag14, 293 sejtek, a HeLa-sejtek stb., amelyek egyszerûen beszerezhetõk például az American Type Culture Collection -tõl (Manassas, VA). Elõnyösnek tekintett gazdasejtek a lymphoid eredetû sejtek, így például a mieloma- és lymphomasejtek. Különösen elõnyös gazdasejtek a P3X63Ag8.63 sejtek (ATCC elérési szám CRL-180) és az SP2/0¹Ag14 sejtek (ATCC elérési szám CRL-181). Az ezen sejtek esetében alkalmazható expressziósvektorok a következõ expressziót szabályozó szekvenciák közül egyet vagy többet tartalmazhatnak, így például tartalmazhatnak replikációs kezdõhelyet, promotert (például késõi vagy korai SV promotereket, CMV promotert (például ; számú amerikai egyesült államokbeli szabadalmi iratok), HSV tk promotert, pgk (foszfoglicerátkináz) promotert, EF¹1 alfa-promotert (például számú amerikai egyesült államokbeli szabadalmi irat), legalább egy emberi immunglobulinpromotert; enhenszert és/vagy feldolgozáshoz szükséges információt biztosító helyeket, így például riboszómakötõ helyet, RNS-szplájszhelyeket, poliadenilációs helyeket (például SV nagy T Ag poli A addíciós helyet), valamint transzkripciós terminátorszekvenciát. Lásd például Ausubel és munkatársai, fentebb; Sambrook és munkatársai, fentebb. A találmány szerinti nukleinsavak vagy proteinek elõállítására alkalmazható további sejtek megismerhetõk és/vagy beszerezhetõk például az American Type Culture Collection Catalogue of Cell Lines and Hybridomas -ból (www.atcc.org) vagy egyéb ismert, vagy kereskedelmi forrásokból. Eukarióta gazdasejtek igénybevétele esetén a poliadenilációs vagy transzkripciós terminátorszekvenciákat jellemzõen a vektor tartalmazza. Terminátorszekvencia például a szarvasmarha növekedési hormon génjébõl származó poliadenilációs szekvencia. A transzkriptum pontos szplájszingját elõsegítõ szekvenciák is igénybe vehetõk. Szplájszingszekvencia például az SV VP1 intronja [Sprague és munkatársai, J. Virol. 4: (1983)]. A vektorba foglalhatók mindemellett a gazdasejtbeli replikációt szabályozó, szakember számára ismert génszekvenciák is. Az EPO-utánzó kapocsmag utánzóanyag tisztítása Az EPO-utánzó kapocsmag utánzóanyag rekombináns sejttenyészetekbõl történõ kinyerésére és kitisztítására jól ismert eljárások alkalmazhatók, ilyenek többek között, de nem kizárólagosan az A¹protein-tisztítás, az ammónium-szulfát- vagy etanolprecipitáció, a savas extrakció, az anion- vagy kationcserélõ kromatográfia, a foszfocellulózkromatográfia, a hidrofób interakciós kromatográfia, az affinitáskromatográfia, a hidroxil-apatit-kromatográfia és a lektinkromatográfia. A tisztítás céljára nagy teljesítményû folyadékkromatográfia (HPLC) is igénybe vehetõ. Lásd például Colligan, Current Protocols in Immunology, vagy Current Protocols in Protein Science, John Wiley & Sons, NY, NY ( ), például 1., 4., 6., 8., 9.,. fejezetek. A találmány szerinti utánzóanyag a természetes úton kitisztított termékeket, a szintetikus kémiai eljárásokkal nyert termékeket, valamint az eukarióta gazdasejtekbõl, például élesztõgomba¹, magasabb rendû növényi, rovar- vagy emlõssejtekbõl rekombinánstechnikákkal elõállított termékeket egyaránt magában foglalja. A rekombináns termelési eljárásban alkalmazott gazdaszervezet függvényében a találmány szerinti EPO-utánzó kapocsmag utánzóanyag lehet glikozilált vagy nem glikozilált, elõnyösen az utóbbi. Ilyen eljárások leírása számos standard laboratóriumi kézikönyvben megtalálható, lásd például Sambrook, fentebb, szakaszok; Ausubel, fentebb,., 12., 13., 16., 18. és. fejezet; Colligan, protein Science, fentebb, fejezetek. 8

9 Utánzóanyag A találmány szerinti izolált utánzóanyag magában foglal a találmány szerinti bármely polinukleotid által a leírásban részletesen tárgyalt módon kódolt EPOutánzó kapocsmag utánzóanyagot, valamint bármely izolált vagy elõállított EPO-utánzó kapocsmag utánzóanyagot. Az EPO-utánzó kapocsmag utánzóanyag elõnyösen legalább egy EPO-proteinligandumhoz vagy receptorhoz kötõdik, így a neki megfelelõ proteinnek vagy fragmensének legalább egy EPO biológiai hatást biztosít. Szakember számára jól ismertek különféle terápiás vagy diagnosztikai szempontból lényeges proteinek, valamint szakember számára szintén jól ismertek az ilyen proteinek biológiai hatásai és a nekik megfelelõ vizsgálati eljárások. Az alábbi 1. táblázatban a találmány szempontjából megfelelõ EPO-utánzó peptidekre ismertetünk példákat, nem korlátozó jelleggel. Ezek a peptidek a találmány szerinti és/vagy szakember számára ismert eljárásokkal állíthatók elõ. A legtöbb esetben az aminosavakat egybetûs kóddal jelöltük. Ezekben a szekvenciákban (és a jelen leírás egészében, hacsak egy adott esetben nem határoztuk meg másként) az X azt jelenti, hogy a, természetes körülmények között elõforduló vagy ismert aminosav vagy azok ismert származékai, vagy bármely módosított aminosav egyaránt szerepelhet az adott helyen. Az említett peptidek bármelyike kapcsolószekvenciával vagy a nélkül tandem módon (vagyis egymás után) kapcsolódhat, a táblázatban felsoroltunk néhány példát a tandem kapcsolt peptidekre. A kapcsolószekvenciákat jelöli, a találmány szerinti leírásban szereplõ bármely kapcsolószekvencia jelen lehet. A tandem ismétlõdéseket és a kapcsolószekvenciákat a könnyebb érthetõség kedvéért egymástól szaggatott vonallal elválasztva ábrázoltuk. Bármely, 1 ciszteinilreziduumot tartalmazó peptid adott esetben keresztkötéssel összekapcsolható egy másik, Cys-tartalmú peptiddel, az egyik vagy mindkét peptid vivõanyaghoz kapcsolt is lehet. A táblázatban keresztkötéssel összekapcsolt peptidekre is bemutatunk néhány példát. Bármely, egynél több Cys reziduumot tartalmazó peptid a peptiden belüli diszulfidkötést is kialakíthat, lásd például az 1. táblázat EPO-utánzó peptidjeit. A táblázatban peptiden belüli diszulfidkötéseket tartalmazó peptidekre is hozunk néhány példát. Az említett peptidek bármelyike a leírásban ismertetett módon derivatizálható, a táblázatban bemutatunk néhány példát a derivatizált peptidekre. Azoknál a származékoknál, ahol a karboxiterminálist aminocsoport fedi, a fedõ aminocsoportot NH 2 -vel jelöltük. Azoknál a származékoknál, amelyekben az aminosavakat nem aminosavgyökökkel szubsztituáltuk, a szubsztitúciót ¹val jelöltük, amely szakember számára ismert bármely gyök helyett állhat, lásd például Bhatnagar és munkatársai (1966), J. Med. Chem. 39: és Cuthbertson és munkatársai (1997), J. Med. Chem. : A J szubsztituens és a Z szubsztituensek (Z, Z 6 Z ) definícióját az 80, és számú amerikai egyesült államokbeli szabadalmi iratok tartalmazzák. Az EPO-utánzó szekvenciák (1. táblázat) esetében a X 2 és X n szubsztituensek, valamint az n egész szám definíciója a WO 96/772 számú nemzetközi közzétételi iratban található. A kivastagítva jelölt reziduumok D¹aminosavak, de adott esetben L¹aminosavak is lehetnek. Mindegyik peptid ellenkezõ értelmû jelzés hiányában peptidkötéseken keresztül kapcsolódik. A rövidítések jegyzéke a leírás végén található. A SEQ ID NO. oszlopban az NR jelzés jelentése, hogy az adott szekvencia esetében nincs szükség a szekvencialistában való feltüntetésre. 1. táblázat EPO-utánzó peptidszekvenciák Szekvencia/szerkezet SEQ ID NO YXCXXGPXTWXCXP 1 YXCXXGPXTWXCXP-YXCXXGPXTWCCXP 1 YXCXXGPXTWXCXP- -YXCXXGPXTWXCXP 1 YXCXXGPXTWXCXP- -( -amine) 1 A K YXCXXGPXTWXCXP- - ( -amine) 1 GGTYSCHFGPLTWVCKPQGG 2 GGDYHCRMGPLTWVCKPLGG 3 GGVYACRMGPITWVCSPLGG 4 VGNYMCHFGPITWVCRPGGG GGLYLCRFGPVTWDCGYKGG 6 GGTYSCHFGPLTWVCKPQGG 7 GGTYSCHFGPLTWVCKPQGG-GGTYSCHFGPLTWVCKPQGG 7 GGTYSCHFGPLTWVCKPQGG- - GGTYSCHFGPLTWVCKPQGG 7 GGTYSCHFGPLTWVCKPQGGSSK 8 GGTYSCHFGPLTWVCKPQGGSSK-GGTYSCHFGPLTWVCKPQGGSSK 8 9

10 GGTYSCHFGPLTWVCKPQGGSSK- -GGTYSCHFGPLTWVCKPQGGSSK 8 GGTYSCHFGPLTWVCKPQGGSS ( -amine) A K 1. táblázat (folytatás) GGTYSCHFGPLTWVCKPQGGSS ( -amine) 8 GGTYSCHFGPLTWVCKPQGGSSK (- -biotin) 8 CX 4 X GPX 6 TWX 7 C 9 GGTYSCHGPLTWVCKPQGG VGNYMAHMGPITWVCRPGG 11 GGPHHVYACRMGPLTWIC 12 GGTYSCHPGPLTWVCKPQ 13 GGLYACHMGPMTWVCQPLRG 14 TIAQYICYMGPETWECRPSPKA 1 YSCHFGPLTWVCK 16 YCHFGPLTWVC 17 X 3 X 4 X GPX 6 TWX 7 X 8 18 YX 2 X 3 X 4 X GPX 6 TWX 7 X 8 19 X 1 YX 2 X 3 X 4 X GPX 6 X 7 X 8 X 9 X X 11 X 1 YX 2 CX 4 X GPX 6 TWX 7 CX 9 X X GGLYLCRFGPVTWDCGYKGG 22 GGTYSCHFGPLTWVCKPQGG 23 VGNYMCHFGPITWVCRPGGG 24 GGVYACRMGPITWVCSPLGG TIAQYICYMGPETWECRPSPKA 26 YSCHFGPLTWVCK 27 YCHFGPLTWVC 28 SCHFGPLTWVCK 29 (AX 2 ) n X 3 X 4 X GPX 6 TWX 7 X Az EPO biológiai aktivitásai szakember számára jól ismertek. Lásd például Anagnostou A. és munkatársai Eritropoietin has a mitogenic and positive chemotactic effect on endothelial cells. Proceedings of the National Academy of Science (USA) 87: (1990); Fandrey J és Jelkman WE Interleukin 1 and tumor necrosis factor-alpha inhibit eritropoietin production in vitro. Annals of the New York Academy of Science 628: 0 (1991); Geissler K és munkatársai. Recombinant human eritropoietin: A multipotential hemopoietic growth factor in vivo and in vitro. Contrib. Nephrol. 87: 1 (1990); Gregory CJ Eritropoietin sensitivity as a differentiation marker in the hemopoietic system. Studies of three erythropoietic colony responses in culture. Journal of Cellular Physiology 89: (1976); Jelkman W és munkatársai Monokines inhibiting eritropoietin production in human hepatoma cultures and in isolated perfused rat kidneys. Life Sci. 0: 1 8 (1992); Kimata H és munkatársai Human recombinant eritropoietin directly stimulates B cell immunoglobulin production and proliferation in serum-free medium. Clinical and Experimental Immunology 8: 11 6 (1991); Kimata H és munkatársai Eritropoietin enhances immunoglobulin production and proliferation by human plasma cells in a serum-free medium. Clin. Immunology Immunopathol. 9: (1991); Kimata H és munkatársai Effect of recombinant human eritropoietin on human IgE production in vitro Clinical and Experimental Immunology 83: (1991); Koury MJ és Bondurant MC Eritropoietin retards DNA breakdown and prevents programmed cell death in erythroid progenitor cells. Science 248: (1990); Lim VS és munkatársai Effect of recombinant human eritropoietin on renal function in humans. Kidney International 37: (1990); Mitjavila MT és munkatársai Autocrine stimulation by eritropoietin and autonomous growth of human erythroid leukemic cells in vitro. Journal of Clinical Investigation 88: (1991); Andre M és munkatársai Performance of an immunoradiometric assay of eritropoietin and results for specimens from anemic and polycythemic patients. Clinical Chemistry 38: (1992); Hankins WD és munkatársai Eritropoietin-dependent and eritropoietin-producing cell lines. Implications for research and for leukemia therapy. Annals of the New York Academy of Science 4: 21 8 (1989); Kendall RGT és munkatársai Storage and preparation of samples for eritropoietin radioimmunoassay. Clin. Lab. Haematology 13: (1991); Krumvieh D és munkatársai Comparison of relevant biological assays for the determination of biological active eritropoietin. Dev. Biol. Stand. 69: 1 22 (1988); Ma DD és munkatársai Assessment of an EIA for measuring human serum eritropoietin as compared with RIA and an in¹vitro bioassay. British Journal of Haematology 80: (1992); Noe

11 1 4 G és munkatársai A sensitive sandwich ELISA for measuring eritropoietin in human serum British Journal of Haematology 80:28 92 (1992); Pauly JU és munkatársai Highly specific and highly sensitive enzyme immunoassays for antibodies to human interleukin 3 (IL3) and human eritropoietin (EPO) in serum. Behring Institut Mitteilungen 90: 112 (1991); Sakata S és Enoki Y Improved microbioassay for plasma eritropoietin based on CFU¹E colony formation. Ann. Hematology 64: 224 (1992); Sanengen T és munkatársai Immunoreactive eritropoietin and erythropoiesis stimulating factor(s) in plasma from hypertransfused neonatal and adult mice. Studies with a radioimmunoassay and a cell culture assay for eritropoietin. Acta Physiol. Scand. 1: 11 6 (1989); Widness JA és munkatársai A sensitive and specific eritropoietin immunoprecipitation assay: application to pharmacokinetic studies. Journal of Lab. Clin. Med. 119: (1992); további információért lásd az egyes biológiai vizsgálati eljárásokban alkalmazott egyedi sejtvonalakat. Az EPO vizsgálatára például a faktorra válaszreakciót adó HCD7, NFS¹, TF¹1 vagy UT¹7 sejtvonalak alkalmazhatók. A csontvelõsejtekbõl képzõdõ CFU-E¹k számának megállapítása alapján az EPO-aktivitás telepképzõ vizsgálati eljárással is meghatározható. Alternatív és teljes mértékben eltérõ detekciós eljárás a citokinek mennyiségi meghatározása RT¹PCR-rel. A legalább egy protein vagy fragmens legalább egy biológiai aktivitását részben, vagy elõnyösen alapvetõ mértékben biztosító EPO-utánzó kapocsmag utánzóanyag képes a proteinbõl vagy fragmensébõl álló ligandum megkötésére, legalább egy olyan aktivitást biztosítva ezzel, ami egyébként a protein legalább egy proteinligandumhoz vagy receptorhoz történõ kötõdésén, vagy egyéb, proteinfüggõ vagy ¹közvetített mechanizmusokon keresztül érvényesül. Az EPO-utánzó kapocsmag utánzóanyag aktivitás alatt olyan EPO-utánzó kapocsmag utánzóanyagot értünk, amely körülbelül 000% közötti mértékben, elõnyösen legalább, 70, 80, 90, 91, 92, 93, 94, 9, 96, 97, 98, 99, 0, 1, 1, 1, 1,, 1, 170, 180, 190, 0, 0, 0, 0, 0,, 00, 0, 0, 700, 800, 900, 00, 00, 00, 00, 000, 00, 7000, 8000, 9000%-ban, vagy a vizsgálati eljárástól függõen akár nagyobb mértékben képes legalább egy proteinfüggõ aktivitás módosítására vagy kifejtésére. Az EPO-utánzó kapocsmag utánzóanyag legalább egy proteinfüggõ aktivitás kifejtésére vonatkozó kapacitásának elbírálására elõnyösen egy találmány szerinti és/vagy szakember számára ismert megfelelõ protein biológiai vizsgálati eljárás vehetõ igénybe. A találmány szerinti EPO-utánzó kapocsmag utánzóanyag legalább egy proteinre, alegységre, fragmensre, részre vagy ezek bármely kombinációjára specifikus legalább egy meghatározott ligandumhoz kötõdik. A találmány szerinti EPO-utánzó kapocsmag utánzóanyag eredetû EPO-utánzó peptid adott esetben a ligandum legalább egy meghatározott ligandumepitópjához kötõdik. A kötõepitóp legalább 1 3 aminosavból álló aminosavszekvenciától egy proteinligandum, például EPO-receptor vagy egy része által alkotott szekvenciából származó, egymást követõ aminosavak meghatározott szakaszának egészéig terjedõ szekvenciák tetszõleges kombinációját tartalmazhatja. Ezek a utánzóanyagok elõállíthatók például az EPO-utánzó kapocsmag utánzóanyag (I) képletben feltüntetett különbözõ részeinek ismert eljárásokkal történõ összekapcsolásával, az EPO-utánzó kapocsmag utánzó-anyagot kódoló legalább egy (vagyis egy vagy több) nukleinsavmolekula ismert rekombináns-dnstechnológiai eljárások vagy bármely egyéb megfelelõ eljárás, például kémiai szintézis alkalmazásával történõ elõállításával és expresszálásával. Az emberi EPO-ligandumokhoz vagy receptorokhoz kötõdõ és legalább részben meghatározott nehézvagy könnyûlánc variábilis régiót tartalmazó utánzóanyagok megfelelõ, szakember számára ismert és/vagy a találmány tárgyát képezõ eljárások, például fág diszpléj [Katsube, Y. és munkatársai, Int J Mol. Med, 1 (3): (1998)] vagy transzgenikus állatokat alkalmazó módszerek segítségével állíthatók elõ. Az EPO-utánzó kapocsmag utánzóanyag a kódolónukleinsav vagy egy része alkalmazásával megfelelõ gazdasejtben expresszálható. Elõnyösen az ilyen utánzóanyagok vagy ligandumkötõ fragmenseik nagy affinitással képesek emberi EPO-ligandumokat vagy receptorokat megkötni (például K D kisebb, vagy egyenlõ, mint körülbelül 7 M). Aminosavkódok A találmány szerinti utánzóanyagot alkotó aminosavakat gyakran rövidítve jelezzük. Amint az szakember számára jól ismert, az aminosavakat egybetûs kóddal, hárombetûs kóddal, névvel vagy három nukleotidból álló kodonokkal azonosíthatjuk (lásd Alberts, B., és munkatársai, Molecular Biology of the Cell, Harmadik kiadás, Garland Publishing, Inc., New York, 1994), lásd 2. táblázat. 2. táblázat Egybetûs kód Hárombetûs kód Név Három nukleotidból álló kodon(ok) A Ala Alanin GCA, GCC, GCG, GCU C Cys cisztin UGC, UGU D Asp aszpartámsav GAC, GAU E Glu glutaminsav GAA, GAG F Phe fenil-alanin UUC, UUU 11

12 2. táblázat (folytatás) Egybetûs kód Hárombetûs kód Név Három nukleotidból álló kodon(ok) G Gly glicin GGA, GGC, GGG, GGU H His hisztidin CAC, CAU I Ile izoleucin AUA, AUC, AUU K Lys lizin AAA, AAG L Leu leucin UUA, UUG, CUA, CUC, CUG, CUU M Met metionin AUG N Asn aszparagin AAC, AAU P Pro prolin CCA, CCC, CCG, CCU Q Gln glutamin CAA, CAG R Arg arginin AGA, AGG, CGA, CGC, CGG, CGU S Ser szerin AGC, AGU, UCA, UCC, UCG, UCU T Thr treonin ACA, ACC, ACG, ACU V Val valin GUA, GUC, GUG, GUU W Trp triptofán UGG Y Tyr tirozin UAC, UAU A találmány szerinti EPO kapocsmag utánzóanyag összetevõinek alábbi leírása a következõ, I. képleten alapul ((V(m)P(n)-L(o)-H(p)-CH2(q)-CH3(r))(s), ahol a V egy immunglobulin variábilis régió N¹terminálisának legalább egy része, a P legalább egy bioaktív peptid, az L legalább egy linker polipeptid, a H legalább egy immunglobulin kapocsrégió legalább egy része, a CH2 legalább egy immunglobulin CH2 konstans régió legalább egy része, a CH3 legalább egy immunglobulin CH3 konstans régió legalább egy része, az m, n, o, p, q, r és az s pedig egymástól függetlenül 0, 1 vagy 2 és közötti egész szám. (A utánzóanyag) különbözõ típusú immunglobulinmolekulákat utánozhat, ilyenek többek között, de nem kizárólag az IgG1, az IgG2, az IgG3, az IgG4, az IgA, az IgM, az IgD, az IgE stb., vagy ezek bármely alosztálya vagy kombinációja. A kapocsmag utánzóanyagokban az opcionális N¹terminális V részlet legalább egy nehézlánc variábilis váz 1 (FR1) régióból származó 1 aminosavat tartalmazhat, amint az az 1 9. ábrákon látható ( azonosító számú szekvencia; SEQ ID NOS:31 39), vagy legalább egy LC variábilis régiót, például amint az a 31. ábrákon látható ( 61. azonosító számú szekvencia; SEQ ID NOS: 61) a /07349 számú, 03/09/¹án benyújtott amerikai egyesült államokbeli ideiglenes szabadalmi bejelentésben, amelyek megfelelnek a 04. június 7¹én benyújtott PCT US04/19783 számú amerikai egyesült államokbeli szabadalmi bejelentés ábráinak, ideértve az ezeken az ábrákon bemutatott szubsztitúciókat, deléciókat vagy inszerciókat, amely ábrák közül az., a 6. és a 8. ábra tekintendõ elõnyösnek. Elõnyösnek tekintendõk továbbá a Q X Q szekvenciát tartalmazó variábilis szekvenciák. A P részlet a szakember számára ismert, vagy a találmány tárgyát képezõ bármely terápiás peptid közül 4 0 legalább egyet tartalmaz, amilyen többek között, de nem kizárólag az 1. táblázatban megadott 1. azonosító számú szekvenciák (SEQ ID NOS: 1 ) legalább egyike vagy ezek bármely kombinációja, vagy konszenzusszekvenciája, vagy bármely fúziós proteinje. Az adott esetben alkalmazott kapcsolószekvencia lehet bármely, a célra megfelelõ, szakember számára ismert peptidlinker. Az elõnyösnek tekintett szekvencia a G és S tetszõleges kombinációit tartalmazza, például ilyen az X1¹X2-X3-X4¹Xn, ahol X lehet G vagy S és az n közötti. Erre vonatkozó, nem korlátozó erejû példák a GS, a GGGS, a GSGGGS, valamint a GSGGGSGG stb. A CH1 rész használaton kívül van és a kapocsrégió N¹terminálisáról változó számú aminosav törölve lett, amint az a /07349 számú, 03/09/¹án benyújtott amerikai egyesült államokbeli ideiglenes szabadalmi bejelentés ábráin látható, amelyek megfelelnek a 04. június 7¹én benyújtott PCT US04/19783 számú amerikai egyesült államokbeli szabadalmi bejelentés ábráinak és a 3. táblázatnak. Egy utánzóanyag kapocsmagrészéhez felhasznált változó számú aminosav többek között, de nem kizárólag legalább egy kapocsrégió N¹terminális aminosavai közül 1, 2, 3, 4,, 6, 7, 8, 9,, 11, 12, 13, 14, 1, 16, 17, 18, 19,, 21, 22, 23, 24,, 26, 27, 28, 29,, 31, 32, 33; 34,, 36, 37, 38, 39,, 41, 42, 43, 44, 4, 46, 47, 48, 49, 0, 1, 2, 3, 4,, 6, 7, vagy 1 3, 2, 2 7, 2 8, 3 9, 4, 9,, 1,, 2,, 0, vagy bármely köztes értéknek vagy tartománynak megfelelõ számú aminosav deléciójának eredményeként alakult ki, például amint az a /07349 számú, 03/09/¹án benyújtott amerikai egyesült államokbeli ideiglenes szabadalmi bejelentés 32. ábráin látható, amelyek megfelelnek a 04. június 7¹én benyújtott PCT US04/19783 számú amerikai egyesült államokbeli 12

13 1 4 0 szabadalmi bejelentés ábráinak, és a 3. táblázatnak, de nem korlátozódik a 99 1 és 17 aminosavak bármelyikének vagy mindegyikének deléciójára, így a 99, 99 8, , , , , 99 11, , 99 1, , , 99 1, , , 99 1 és pozíciójú aminosavakra, amelyek megfelelnek 03/09/¹án benyújtott /07349 számú ideiglenes amerikai egyesült államokbeli szabadalmi bejelentés 32. ábráinak, amelyek megfelelnek a 04. június 7¹én benyújtott PCT US04/19783 számú amerikai egyesült államokbeli szabadalmi bejelentés ábráinak, és a 3. táblázatnak, amelyek megfelelnek a azonosító számú szekvenciáknak (SEQ ID NOS:62 70), ideértve a 03/09/¹án benyújtott /07349 számú ideiglenes amerikai egyesült államokbeli szabadalmi bejelentés 32. ábráin, valamint a 04. június 7¹én benyújtott PCT US04/19783 számú amerikai egyesült államokbeli szabadalmi bejelentés ábráin és a 3. táblázatban látható szubsztitúciókat, inszerciókat vagy deléciókat. A találmány elõnyös megvalósítási módjaiban a kapocsmagrégió egészen egy Cys-reziduumig terjedõ, de azt nem tartalmazó, vagy egészen egy Cys- Pro-Xaa-Cys szekvenciáig terjedõ, de azt nem tartalmazó deléciót magában foglaló kapocsmagrégió biztosítása érdekében kapocsrégió N¹terminális deléciót tartalmaz. A találmány egy további elõnyös megvalósítási módjában a kapocsmag utánzóanyagban található kapocsmag szekvenciák a 36. ábrán (66. azonosító számú szekvencia; SEQ ID NO:66) (IgGI) látható vagy aminosavakat; a 37. ábrán (67. azonosító számú szekvencia; SEQ ID NO:67) (IgG2) látható 1. vagy 9 1. aminosavakat, a 38. ábrán (68. azonosító számú szekvencia; SEQ ID. No:68) (IgG3) látható , , 1 1., , , 1 1., , , 1., és aminosavakat, vagy a 39. ábrán (69. azonosító számú szekvencia; SEQ ID NO:69) (IgG4) látható 6 1. vagy 9 1. aminosavakat tartalmazzák. A CH2, CH3 és adott esetben a CH4 szekvencia bármely megfelelõ emberi vagy azzal kompatibilis szekvencia lehet, ilyenek például a 04. június 7¹én benyújtott PCT US04/19783 számú amerikai egyesült államokbeli szabadalmi bejelentés ábráinak megfelelõ, a 03/09/¹án benyújtott /07349 számú ideiglenes amerikai egyesült államokbeli szabadalmi bejelentés ábráin, valamint a 3. táblázatban látható, vagy szakember számára ismert szekvenciák, vagy ezek bármely kombinációja vagy konszenzusszekvenciája, vagy bármely fúziós proteinje. Egy EPO-utánzó kapocsmag utánzóanyag mûködéséhez nélkülözhetetlen aminosavak szakember számára ismert eljárásokkal azonosíthatók, ilyenek például a helyirányított mutagenezis vagy az alaninszkennelõ mutagenezis [például Ausubel, fentebb, 8., 1. fejezet; Cunningham és Wells, Science 244:81 8 (1989)]. Az utóbbi eljárással a molekula minden egyes reziduumánál egyszeri alaninmutációt hoznak létre. Az így nyert mutáns molekulákat ezek után biológiai aktivitásuk, így például, de nem kizárólag legalább egy, találmány szerinti vagy szakember számára ismert, proteinhez kapcsolódó aktivitás szempontjából vizsgálják. Az EPO-utánzó kapocsmag utánzóanyag vagy meghatározott része vagy variánsa kötõdése szempontjából kritikus helyek szerkezeti elemzéssel, például kristályosítással, magmágneses rezonanciavizsgálattal vagy fotoaffinitásjelzéssel is azonosíthatók [Smith és munkatársai, J. Mol. Biol. 224: (1992) és de Vos és munkatársai, Science :6 312 (1992)]. A utánzóanyagok az (I) képlet P részleteként nem kizárólagosan legalább egy részt, szakaszt vagy ezekbõl álló kombinációt tartalmazhatnak az 1. azonosító számú szekvenciák közül háromból vagy többõl, de legalább egyet tartalmaznak (SEQ ID NOS: 1.). A fenti aktivitásokat fokozni vagy fenntartani képes nem kizárólagos variánsok például, de nem kizárólag a fentiekben említett polipeptidek bármelyike, amely az EPO-utánzó kapocsmag utánzóanyag megfelelõ biológiai aktivitásait vagy funkcióit lényeges mértékben nem befolyásoló legalább egy szubsztitúciónak, inszerciónak vagy deléciónak megfelelõ legalább egy mutációt tartalmaz. Egy EPO-utánzó kapocsmag utánzóanyag adott esetben az (I) képletbeli P részletként legalább egy polipeptidbõl származó legalább egy funkcionális részt, az 1. azonosító számú szekvenciák (SEQ ID NOS: 1 ) 90 0%-ának megfelelõ szekvenciák közül legalább egyet tartalmazhat. Egy EPO-utánzó kapocsmag utánzóanyag továbbá adott esetben az (I) képletbeli P részletként az 1. azonosító számú szekvenciák (SEQ ID NOS: 1 ) közül egynek vagy többnek megfelelõ aminosavszekvenciát tartalmazhat. A találmány egy megvalósítási módjában a P aminosavszekvencia vagy annak egy részlete körülbelül 90 0%-ban (vagyis 90, 91, 92, 93, 94, 9, 96, 97, 98, 99, 0 vagy ezek közti bármely tartománynak vagy értéknek megfelelõ százalékos mértékben) azonos az 1. azonosító számú szekvenciák (SEQ ID NOS:1 ) közül legalább egy megfelelõ szakaszának megfelelõ aminosavszekvenciával. A 90 0%¹os (vagyis 90, 91, 92, 93, 94, 9, 96, 97, 98, 99, 0 vagy ezek közti bármely tartománynak vagy értéknek megfelelõ százalékos mértékû) aminosavegyezés megállapítása szakember számára ismert számítógépes algoritmussal történik. A utánzóanyagok egy EPO-utánzó kapocsmag utánzóanyag egymást követõ aminosavai közül tetszõleges számút tartalmazhatnak, ahol ez a szám egy EPO-utánzó kapocsmag utánzóanyag egymást követõ aminosavai 0%¹a közötti egész számok egyike. Adott esetben az egymást követõ aminosavakból álló alszekvencia 2, 3, 4,, 6, 7, 8, 9,, 11, 12, 13, 14, 1, 16, 17, 18, 19,, 21, 22, 23, 24,, 26, 27, 28, 29,,, 0,, 70, 80, 90, 0, 1, 1, 1, 1,, 1, 170, 180, 190, 0, 2, 2, 2, 2, 0 vagy több, vagy ezek közötti tetszõleges tartománynak vagy értéknek megfelelõ aminosavhosszúságú. Mindezek mellett az ilyen alszekvenciák száma 1 és közötti tetszõleges egész szám, így legalább 2, 3, 4,, 6, 7, 8, 13

14 9,, 11, 12, 13, 14, 1, 16, 17, 18, 19, vagy több lehet. A biológiailag aktív utánzóanyagok a natív (nem szintetikus), endogén vagy rokon, ismerten inszertált vagy fuzionált protein vagy specifikus része vagy variánsa specifikus aktivitásának legalább %, % vagy %-ával, elõnyösen legalább 0%, % vagy 70%-ával, legelõnyösebben legalább 80%, 90% vagy 9 00%-ával rendelkeznek. Szakember számára jól ismertek az enzimatikus aktivitás és a szubsztrátspecifitás vizsgálatára és mennyiségi meghatározására szolgáló eljárások. A találmány szerinti emberi utánzóanyagok és ligandumkötõ fragmensek szerves gyök kovalens kötéssel történõ hozzákapcsolásával módosíthatók. E módosítás eredményeként elõnyösebb farmakokinetikai tulajdonságokkal (például megnövelt in vivo szérumbeli felezési idõvel) rendelkezõ EPO-utánzó kapocsmag utánzóanyag vagy ligandumkötõ fragmens jöhet létre. A szerves gyök lehet lineáris vagy elágazódó hidrofil polimercsoport, zsírsavcsoport vagy zsírsav-észtercsoport. A találmány meghatározott megvalósítási módjaiban a hidrofil polimercsoport körülbelül 800-tól körülbelül daltonig terjedõ molekulatömegû polialkánglikol [például polietilénglikol (PEG), polipropilénglikol (PPG)], szénhidrátpolimer, aminosavpolimer vagy poli(vinil-pirrolidon) lehet, a zsírsav vagy zsírsavészter-csoport pedig körülbelül 8 és körülbelül közötti számú szénatomot tartalmazhat. A módosított utánzóanyagok az EPO-utánzó kapocsmag utánzóanyaghoz közvetve vagy közvetlenül kovalens kötéssel kapcsolódó egy vagy több szerves gyököt tartalmazhatnak. Az EPO-utánzó kapocsmag utánzóanyaghoz kovalens kötéssel kapcsolódó minden egyes szerves gyök önállóan lehet hidrofil polimercsoport, zsírsavcsoport vagy zsírsav-észter-csoport. A zsírsav kifejezés a monokarboxilsavakat és a dikarboxilsavakat egyaránt magában foglalja. A hidrofil polimercsoport kifejezés olyan szerves polimerre utal, amely vízben jobban oldódik, mint oktánban. Például a polilizin jobban oldódik vízben, mint oktánban. Ennek megfelelõen a találmány tárgyát képezi a polilizinnel kialakított kovalens kötéssel módosított EPO-utánzó kapocsmag utánzóanyag. A utánzóanyagok módosítására alkalmas hidrofil polimerek lehetnek lineárisak vagy elágazódók, ilyenek például többek között a polialkánglikolok (például PEG, monometoxi-polietilénglikol (mpeg), PPG stb.), szénhidrátok (például dextrán, cellulóz, oligoszacharidok, poliszacharidok stb.), hidrofil aminosavak polimerei (például polilizin, poliarginin, poliaszpartát stb.), polialkán-oxidok (például polietilénoxid, polipropilén-oxid stb.) és poli(vinil-pirrolidon). A találmány szerinti EPO-utánzó kapocsmag utánzóanyagot módosító hidrofil polimer önálló molekulaként elõnyösen körülbelül 800 és körülbelül 000 közötti molekulatömeggel rendelkezik. Például a PEG 00, PEG S000, PEG 700, PEG 9000, PEG 000, PEG 12 00, PEG 1 000,ésPEG 000 megnevezések használhatók, ahol az alsó kitevõ a polimer átlagos molekulatömege daltonban A hidrofil polimercsoport egytõl körülbelül hatig terjedõ számú alkil¹, zsírsav- vagy zsírsav-észter-csoporttal szubsztituálható. A zsírsav- vagy zsírsav-észtercsoporttal szubsztituált hidrofil polimerek megfelelõ eljárások alkalmazásával állíthatók elõ. Például amincsoportot tartalmazó polimer zsírsav vagy zsírsav-észter karboxilátjához kapcsolható, és zsírsavon vagy zsírsav-észteren található (például N,N-karbonil diimidazollal) aktivált karboxilátpolimer hidroxilcsoportjához kapcsolható. Az utánzóanyagok módosítására alkalmas zsírsavak és zsírsav-észterek lehetnek telítettek, vagy egy vagy több telítetlen egységet is tartalmazhatnak. A utánzóanyagok módosítására alkalmas zsírsavak például az n¹dodekanoát (C12, laurát), az n¹tetradekanoát (C14, mirisztát), az n¹oktadekanoát (C18, sztearát), az n¹eikozanoát (C, arahidrát), az n¹dokozanoát (C22, behanát), az n¹triakontanoát (C), az n¹tetrakontanoát (C), a cisz-9-oktadekanoát (C18, oleát), az összes cisz-,8,11,14-eikozatetranoát (C, arachidonát), az oktándiosav, a tetradekándiosav, az oktadekándiosav, a dokozándiosav stb. Megfelelõ zsírsavészterek például a dikarboxilsavak lineáris vagy elágazódó kis szénatomszámú alkilcsoportot tartalmazó monoészterei. A kis szénatomszámú alkilcsoport 1 és körülbelül 12 közötti, elõnyösen 1 és körülbelül 6 közötti szénatomot tartalmaz. A módosított emberi utánzóanyagok megfelelõ eljárásokkal állíthatók elõ, ilyen például az egy vagy több módosítóágenssel történõ reagáltatás. A módosítóágens kifejezés aktiválócsoportot tartalmazó megfelelõ szerves csoportot (például hidrofil polimert, zsírsavat, zsírsav-észtert) jelöl. Az aktiválócsoport olyan kémiai gyök vagy funkcionális csoport, amely megfelelõ körülmények között egy második kémiai csoporttal képes reagálni, kovalens kötést alakítva ki ezzel a módosítóágens és a második kémiai csoport között. Aminreaktív aktiválócsoportok lehetnek például elektrofil csoportok, mint a tozilát, mezilát, halo (klór, bróm, fluor, jód), N¹hidroxi-szukcinilimidil-észterek (NHS) stb. A tiolokkal reakcióképes aktiválócsoportok például a maleimid, a jód-acetil, az akriloil, a piridil-diszulfidok, az ¹tiol-2-nitro-benzoesav tiol (TNB-tiol) stb. Egy aldehid funkcionális csoport amin- vagy hidrazidtartalmú molekulákhoz kapcsolható, egy azidcsoport pedig háromértékû foszforcsoporthoz kapcsolódva foszforamidátvagy foszforimidkötéseket hoz létre. Az aktiválócsoportok molekulákba foglalására alkalmas eljárások szakember számára ismertek [lásd például Hermanson, G. T., Bioconjugate Techniques, Academic Press> San Diego, CA (1996)]. Egy aktiválócsoport a szerves csoporthoz (például hidrofil polimerhez, zsírsavhoz, zsírsav-észterhez) közvetlenül vagy kapcsológyökön, például kétértékû C 1 C 12 csoporton keresztül köthetõ, utóbbiban egy vagy több szénatom heteroatommal, például oxigénnel, nitrogénnel vagy kénnel helyettesíthetõ. Megfelelõ kapcsológyökök például a tetraetilénglikol, (CH 2 ) 3, a NH (CH 2 ) 6 NH, a (CH 2 ) 2 NH és a CH 2 O CH r CH z O CH 2 CH 2 O CH NH. Kapcsológyököt tartalmazó módosítóágensek elõállít- 14

15 hatók például mono-boc-alkildiamin (például mono- Boc-etilén-diamin, mono-boc-diamino-hexán) 1¹etil-3- (3¹dimetil-amino-propil) karboimid (EDC) jelenlétében zsírsavval történõ reagáltatásával, aminek során a szabad amin és a zsírsav-karboxilát között amidcsoport jön létre. A Boc védõcsoport trifluor-ecetsavval (TFA) eltávolítható a termékbõl, az így szabaddá váló elsõdleges amin a leírtak szerint egy másik karboxiláthoz kapcsolható, vagy maleinsavanhidriddel reagáltatva és a kapott terméket ciklizálva a zsírsav aktivált maleimidszármazéka nyerhetõ (lásd például Thompson és munkatársai, WO 92/16221 számú nemzetközi közzétételi irat). A módosított utánzóanyagok elõállíthatók emberi EPO-utánzó kapocsmag utánzóanyag módosítóágenssel történõ reagáltatásával. Például a szerves gyökök nem helyspecifikus módon az EPO-utánzó kapocsmag utánzóanyaghoz köthetõk aminreaktív módosítóágens, például PEG NHS észter alkalmazásával. Módosított emberi utánzóanyagok állíthatók elõ továbbá EPOutánzó kapocsmag utánzóanyag diszulfidhídjainak (például láncon belüli diszulfidhídjainak) redukálásával. A módosított EPO-utánzó kapocsmag utánzóanyag a redukált EPO-utánzó kapocsmag utánzóanyag tiolreaktív módosítóágenssel történõ reagáltatásával állítható elõ. EPO-utánzó kapocsmag utánzóanyag specifikus helyeihez kötött szerves gyököt tartalmazó módosított emberi utánzóanyagok megfelelõ eljárások, például reverz proteolízis [Fisch és munkatársai, Bioconjugate Chem., 3: (1992); Werlen és munkatársai, Bioconjugate Chem., : (1994); Kumaran és munkatársai, Protein Sci 6(): (1997); Itoh és munkatársai, Bioorg. Chem. 24(1): 9 68 (1996); Capellas és munkatársai, Biotechnol. Bioeng., 6(4): (1997)], valamint a Hermanson, G. T., Bioconjugate Techniques, Academic Press: San Diego, CA (1996) címû munkájában leírt eljárások segítségével állíthatók elõ. EPO-utánzó kapocsmag utánzóanyag készítmények A találmány tárgyát legalább egy, legalább kettõ, legalább három, legalább négy, legalább öt, legalább hat vagy több, találmány szerinti, vagy szakember számára ismert utánzóanyagot vagy azok meghatározott részét vagy variánsát tartalmazó, természetes körülmények között elõ nem forduló készítményben, keverékben vagy alakban lévõ legalább egy EPO-utánzó kapocsmag utánzóanyagból, vagy annak részébõl vagy variánsából álló készítmény képezi. Az ilyen készítmények szakember számára ismert vagy találmány szerinti folyékony vagy szilárd oldatok, keverékek, szuszpenziók, emulziók vagy kolloidok, amelyek összetétele tömeg¹, térfogat¹, koncentráció¹, molaritásvagy molalitásszázalékban van megadva. Ezek a szakember számára ismert vagy a találmány tárgyát képezõ folyékony, gáz vagy szilárd oldat, keverék, szuszpenzió, emulzió vagy kolloid alakú készítmények tartalma 0, ,9999 tömeg¹, térfogat¹, koncentráció¹, molaritás- vagy molalitásszázalék, valamint a fenti értékek közti bármely érték vagy tartomány, így többek között, de nem kizárólag 0,00001, 0,00003, 0,0000, 0,00009, 0,0001, 0,0003, 0,000, 0,0009, 0,001, 0,003, 0,00, 0,009, 0,01, 0,02, 0,03, 0,0, 0,09, 0,1, 0,2, 0,3, 0,4, 0,, 0,6, 0,7, 0,8, 0,9, 1,0,1,1,1,2,1,3, 1,4, 1,, 1,6, 1,7, 1,8, 1,9, 2,0, 2,1, 2,2, 2,3, 2,4, 2,, 2,6, 2,7, 2,8, 2,9, 3,0, 3,1, 3,2, 3,3, 3,4, 3,, 3,6, 3,7, 3,8, 3,9, 4,0, 4,3, 4,, 4,6, 4,7, 4,8, 4,9,, 6, 7, 8, 9,, 1,,,,,, 4, 0,,, 6, 70, 71, 72, 73, 74, 7, 76, 77, 78, 79, 80, 81, 82, 83, 84, 8, 86, 87, 88, 89, 90, 91, 92, 93, 94, 9, 96, 97, 98, 99, 99,1, 99,2, 99,3, 99,4, 99,, 99,6, 99,7, 99,8, vagy 99,9. Ezen találmány szerinti készítmények koncentrációja ezek alapján többek között, de nem kizárólag 0, mg/ml és/vagy 0, mg/g. A készítmény adott esetben a következõ vegyületek vagy proteinek legalább egyikének hatékony mennyiségét tartalmazhatja: antiinfektív drog, szív-érrendszeri (CV) drog, központi idegrendszeri (CNS) drog, autonóm idegrendszeri (ANS) drog, légzõszervi drog, gyomor-bélrendszeri drog, hormonális drog, folyadék- vagy elektrolit-egyensúlyra ható drog, hematológiai drog, daganatellenes drog, immunmoduláló drog, szem¹, fül- vagy orrkezelésre szolgáló drog, helyi kezelésre szolgáló drog, táplálkozásra ható drog stb. Ezek a drogok és kiszerelésük, indikációik, dozírozásuk és beadásuk szakember számára jól ismertek (lásd például Nursing 01 Handbook of Drugs, 21. kiadás, Springhouse Corp., Springhouse, PA, 01; Health Professional s Drug Guide 01, szerk., Shannon, Wilson, Stang, Prentice-Hall, Inc, Upper Saddle River, NJ; Pharmacotherapy Handbook, Wells és munkatársai, szerk., Appleton & Lange, Stamford, CT). Az antiinfektív drog a következõk legalább egyike lehet: amõbicid, antiprotozoikum, anthelmintikum, gombaellenes szer, maláriaellenes szer, gümõkórellenes szer vagy lepraellenes szer, aminoglikozid, penicillin, cefalosporin, tetraciklin, szulfonamid, fluorokinolon, vírusellenes szer, makrolid antiinfektívum, valamint egyéb antiinfektívum. A CV drog a következõk legalább egyike lehet: inotróp szer, aritmiaellenes szer, anginaellenes szer, magasvérnyomás-ellenes szer, lipémiaellenes szer, valamint egyéb kardiovaszkuláris drog. A CNS drog a következõk legalább egyike lehet: nem kábító fájdalomcsillapító vagy antipiretikum, nem szteroid gyulladáscsökkentõ drog, narkotikum, vagy opioid fájdalomcsillapító, nyugtató-altató szer, görcsoldó szer, antidepresszáns, anxiolytikum, antipszichotikum, központi idegrendszert stimuláló szer, Parkinson-kór-ellenes szer, egyéb központi idegrendszerre ható drog. Az ANS drog a következõk legalább egyike lehet: kolinergikum (paraszimpatomimetikum), antikolinergikum, adrenergikum (szimpatomimetikum), adrenerg blokkoló (szimpatolitikum), vázizomrelaxáns, neuromuszkuláris blokkoló. A légzõszervi drog a következõk legalább egyike lehet: antihisztamin, hörgõtágító, köptetõ vagy köhögéscsillapító, egyéb légzõszervi drog. A gasztrointesztinális drog a következõk legalább egyike lehet: savellenes szer vagy legalább egy adszorbens, vagy legalább egy flatulációellenes szer, emésztõenzim, 1

16 1 4 0 vagy legalább egy epekõoldó, hasmenéscsillapító, hashajtó, hányáscsillapító vagy fekélyellenes drog. A hormonális drog a következõk legalább egyike lehet: kortikoszteroid, androgén vagy legalább egy anabolikus szteroid, ösztrogén, vagy legalább egy progesztin, gonadotropin, antidiabetikum, vagy legalább egy glukagon, pajzsmirigyhormon, pajzsmirigyhormon-antagonista, hipofízishormon, mellékpajzsmirigy (hormon)- szerû drog. A folyadék- és elektrolitegyensúlyra ható drog a következõk legalább egyike lehet: diuretikum, elektrolit vagy legalább egy pótlóoldat, savanyítószer vagy legalább egy lúgosítóoldat. A hematológiai drog a következõk legalább egyike lehet: vörösvértestképzõ szer, véralvadásgátló, vérszármazék, trombolitikus enzim. A daganatellenes szer a következõk legalább egyike lehet: alkilezõ drog, antimetabolit, antibiotikum típusú daganatellenes szer, hormonegyensúlyt módosító daganatellenes szer, egyéb daganatellenes szer. Az immunmoduláló drog a következõk legalább egyike lehet: immunszuppresszáns, vakcina vagy legalább egy toxoid, antitoxin, vagy legalább egy antivenin, immunszérum, biológiai válaszreakciót módosító szer. A szem¹, fül- vagy orrkezelésre alkalmazott drog a következõk legalább egyike lehet: szemészeti antiinfektívum, szemészeti gyulladáscsökkentõ, miotikum, midriatikum, szemészeti érszûkítõ, egyéb szem¹, fül- és orrgyógyászati szer. A helyi kezelésre szánt drog a következõk legalább egyike lehet: helyi antiinfektívum, rühatkaellenes szer vagy legalább egy pedikulicid szer, helyi alkalmazásra szánt kortikoszteroid. A táplálkozásra ható drog a következõk legalább egyike lehet: vitamin, ásványi anyag vagy kalorikum. Lásd például a Nursing 01 Drug Handbook tartalmát fentebb. A találmány szerinti EPO-utánzó kapocsmag utánzóanyag ellenanyag vagy polipeptid készítmények tartalmazhatnak továbbá egy ilyen módosításra, kezelésre vagy terápiára szoruló sejt, szövet, szerv, állat vagy páciens ellen irányuló, legalább egy EPO-utánzó kapocsmag utánzóanyag proteint vagy ellenanyagot tartalmazó megfelelõ és/vagy hatékony mennyiségû készítményt vagy gyógyászati készítményt, amely adott esetben a következõk legalább egyikét is tartalmazza: TNF-antagonista (például, de nem kizárólag kémiai vagy protein TNF-antagonista, TNF elleni monoklonális vagy poliklonális ellenanyag vagy fragmens, oldható TNF-receptor (például p, p70 vagy p8) vagy fragmense, mindezek fúziós polipetidei, vagy kismolekulájú TNF-antagonista, például TNF kötõ protein I vagy II (TBP¹I vagy TBP¹II), nerelimomab, infliximab, enteracept, CDP-71, CDP-870, afelimomab, lenerecept stb.), reumaellenes szer (például metotrexát, auranofin, aurotioglükóz, azatioprin, etanercept, arany nátrium tiomalát, hidroxi-klorokvin-szulfát, leflunomid, szulfaszalazin), izomrelaxáns, narkotikum, nem szteroid gyulladáscsökkentõ drog (NSAID), fájdalomcsillapító, altatószer, nyugtató, helyi érzéstelenítõ, neuromuszkuláris blokkoló, antimikrobiális szer (például aminoglikozid, gombaellenes szer, antiparazitikum, vírusellenes szer, karbapenem, cefalosporin, fluorokinolon, makrolid, penicillin, szulfonamid, tetraciklin, egyéb antimikrobiális szer), övsömörellenes szer, kortikoszteroid, anabolikus szteroid, cukorbetegséggel kapcsolatos hatóanyag, ásványi anyag, tápanyag, pajzsmirigyágens, vitamin, kalciumhoz kapcsolódó hormon, hasmenésellenes szer, köhögéscsillapító, hányáscsillapító, fekélyellenes szer, hashajtó, véralvadásgátló, eritropoietin (például epoetin alfa), filgrastim (például G¹CSF, Neupogen), sargramostim (GM-CSF, Leukine), immunizálás, immunglobulin, immunszuppresszív anyag (például basiliximab, ciklosporin, daklizumab), növekedési hormon, hormonhelyettesítõ drog, ösztrogénreceptormodulátor, midriatikum, cikloplegikum, alkilezõágens, antimetabolit, mitózisgátló, radiofarmakon, antidepresszáns, mániaellenes ágens, antipszichotikum, feszültségoldó szer, altatószer, szimpatomimetikum, stimuláns, donepezil, takrin, asztmaellenes szer, béta-antagonista, inhalációs szteroid, leukotriéninhibitor, metilxantin, kromolin, epinefrin vagy analógja, dornáz alfa (Pulmozyme), citokin vagy citokinantagonista. Citokin lehet például, de nem kizárólagosan az IL 1 IL 23 citokinek bármelyike. A megfelelõ dózisok szakember számára jól ismertek. Lásd például Wells és munkatársai, szerk. Pharmacotherapy Handbook, 2. kiadás, Appleton and Lange, Stamford, CT (00); PDR Pharmacopoeia, Tarascon Pocket Pharmacopoeia 00, Deluxe Edition, Tarascon Publishing, Loma Linda, CA (00). Ezek a készítmények tartalmazhatnak továbbá legalább egy találmány szerinti ellenanyaggal vagy polipeptiddel társult, kapcsolt, együtt kiszerelt vagy együttesen adagolt toxinmolekulákat is. Adott esetben a toxin képes lehet a kóros sejt vagy szövet szelektív elpusztítására. A kóros sejt ráksejt vagy egyéb sejt egyaránt lehet. A toxin többek között, de nem kizárólag egy toxin, például ricin, diftériatoxin, méregtoxin, vagy bakteriális toxin legalább egy funkcionális citotoxikus doménjét tartalmazó tisztított vagy rekombináns toxin vagy toxinfragmens is lehet. A toxin kifejezés magában foglalja az emberben és más emlõsökben bármely kóros állapotot, így például halálra vezetõ toxikus sokkot elõidézni képes bármely természetes körülmények között elõforduló, mutáns vagy rekombináns baktérium vagy vírus által termelt endotoxinokat és exotoxinokat. Ilyen toxinok többek között, de nem kizárólag az enterotoxigenikus E. coli által termelt hõérzékeny enterotoxin (LT), hõstabil enterotoxin (ST), Shigella citotoxin, Aeromonas enterotoxinok, toxikus sokk szindróma toxin¹1 (TSST 1), Staphylococcus enterotoxin A (SEA), B (SEB) vagy C (SEC), Streptococcus enterotoxinok stb. Ilyen baktériumok lehetnek például, de nem kizárólag enterotoxigenikus E. coli (ETEC) törzsek, enterohemorrágiás E. coli (például 017:H7 szerotípusbeli törzsek), Staphylococcus fajok (például Staphylococcus aureus, Staphylococcus pyogenes), Shigella fajok (például Shigella dysenteriae, Shigella flexneri, Shigella boydii, és Shigella sonnei), Salmonella fajok (például Salmonella typhi, Salmonella choleraesuis, Salmonella enteritidis), Clostridium fajok (például Clostridium perfringens, Clostridium difficile, Clostridium botulinum), Campylobacter fajok (például Campylobacter jejuni, 16

17 Campylobacter fetus), Helicobacter fajok (például, Helicobacter pylori), Aeromonas fajok (például, Aeromonas sobria, Aeromonas hydrophila, Aeromonas caviae), Pleisomonas shigelloides, Yersina enterocolitica, Vibrio fajok (például Vibrio cholerae, Vibrio parahemolyticus), Klebsiella fajok, Pseudomonas aeruginosa és Streptococcusok. Lásd például Stein, szerk., INTERNAL ME- DICINE, 3. kiadás, pp 1 13, Little, Brown and Co., Boston, (1990); Evans és munkatársai, szerk., Bacterial Infections of Humans: Epidemiology and Control, 2. kiadás, pp 239 4, Plenum Medical Book Co., New York (1991); Mandell és munkatársai, Principles and Practice of Infectious Diseases, 3. kiadás., Churchill Livingstone, New York (1990); Berkow és munkatársai, szerk., The Merck Manual, 16. kiadás, Merck and Co., Rahway, N. J., 1992; Wood és munkatársai, FEMS Microbiology Immunology, 76: (1991); Marrack és munkatársai, Science, 248: (1990). A találmány szerinti EPO-utánzó kapocsmag utánzóanyag készítmények tartalmazhatnak továbbá legalább egy megfelelõ kiegészítõanyagot, többek között, de nem kizárólag hígítószert, kötõanyagot, stabilizálószert, puffert, sót, lipofil oldószert, tartósítószert, adjuvánst stb. Elõnyös a gyógyászati szempontból elfogadható kiegészítõanyagok alkalmazása. Szakember számára jól ismertek az ilyen steril oldatok és azok elõállítására szolgáló eljárások, lásd például Gennaro, szerk., Remington s Pharmaceutical Sciences, 18. kiadás, Mack Publishing Co. (Easton, PA) Szakember számára ismert, vagy a találmány szerinti megoldás részét képezõ módokon rutinszerûen kiválaszthatók a beadási mód, oldhatóság és/vagy az EPOutánzó kapocsmag utánzóanyag készítmény stabilitása szempontjából megfelelõ, gyógyászati szempontból elfogadható vivõanyagok. A találmány szerinti készítményben alkalmazható gyógyászati vehikulumok és adalékanyagok lehetnek többek között, de nem kizárólag proteinek, peptidek, aminosavak, lipidek, valamint szénhidrátok (például cukrok, ideértve a monoszacharidokat, a di¹, tri¹, tetraés oligoszacharidokat; a derivatizált cukrokat, például az alditolokat, aldonsavakat, észterezett cukrokat stb., valamint a poliszacharidokat vagy cukorpolimereket), amelyek jelen lehetnek önmagukban vagy kombinációban, és amelyek egyedül vagy kombinációban a készítmény 1 99,99 térfogat vagy tömegszázalékát tehetik ki. Példaértékû proteinvehikulumok például a szérumalbumin, például az emberi szérumalbumin (HSA), a rekombináns emberi albumin (rha), a zselatin, a kazein stb. Az EPO-utánzó kapocsmag utánzóanyag vagy annak specifikus részét vagy variánsát alkotó, puffer szerepet is betöltõ reprezentatív aminosavak az alanin, glicin, arginin, betain, hisztidin, glutaminsav, aszpartámsav, cisztein, lizin, leucin, izoleucin, valin, metionin, fenil-alanin, aszpartám stb. Egy elõnyös aminosav a glicin. A találmány szerinti megoldásban alkalmazható szénhidrát-vehikulumok többek között lehetnek monoszacharidok, például fruktóz, maltóz, galaktóz, glükóz, D¹mannóz, szorbóz stb., diszacharidok, például laktóz, szacharóz, trehalóz, cellobióz stb., poliszacharidok, például raffinóz, melezitóz, maltodextrinek, dextránok, keményítõk stb., valamint alditolok, így például mannitol, xilitol, maltitol, laktitol, xilitol szorbitol (glucitol), mioinozitol stb. A találmány szerinti megoldásban elõnyösen alkalmazható szénhidrát-vehikulumok a mannitol, a trehalóz és a raffinóz. Az EPO-utánzó kapocsmag utánzóanyag készítmények tartalmazhatnak továbbá puffert vagy ph¹módosítóágenst; a puffer jellemzõen szerves savból vagy bázisból elõállított só. Reprezentatív pufferek a szerves savak, például a citromsav, az aszkorbinsav, a glükonsav, a szénsav, a borkõsav, a borostyánkõsav, az ecetsav vagy a ftálsav sói; a trisz, a trometamin-hidroklorid vagy a foszfátpufferek. A találmány szerinti készítményekben elõnyösen alkalmazható pufferek a szerves savak sói, mint például a citrát. Mindezeken túl a találmány szerinti EPO-utánzó kapocsmag utánzóanyag készítmények tartalmazhatnak polimer vehikulumokat/adalékanyagokat, így például poli(vinil-pirrolidon)-okat, fikollokat (cukorpolimerek), dextrátokat (például ciklodextrineket, például 2¹hidroxi-propil-6-ciklodextrint), polietilénglikolokat, ízesítõanyagokat, antimikrobiális ágenseket, édesítõszereket, antioxidánsokat, antisztatikus ágenseket, szörfaktánsokat (például poliszorbátokat, amilyen például a TWEEN és a TWEEN 80 ), lipideket (például foszfolipideket, zsírsavakat), szteroidokat (például koleszterolt) és kelátképzõ ágenseket (például EDTA¹t). Ezek és a találmány szerinti EPO-utánzó kapocsmag utánzóanyag készítményekben alkalmazható további gyógyászati vehikulumok és/vagy adalék anyagok szakember számára ismertek, például a következõ forrásokból: Remington: The Science & Practice of Pharmacy, 19. kiadás, Williams & Williams, (199); Physician s Desk Reference, 2. kiadás, Medical Economics, Montvale, NJ (1998). Elõnyösnek tekintett vivõanyagok vagy vehikulumanyagok a szénhidrátok (például szacharidok vagy alditolok) és a pufferek (például citrát) vagy polimer ágensek. Kiszerelések Amint a fentiekbõl kitûnik, a találmány tárgyát elõnyösen megfelelõ fiziológiás sóoldatot vagy más kiválasztott sót tartalmazó puffert magukban foglaló stabil kiszerelések, valamint adott esetben tartósítószert tartalmazó tartósított oldatok vagy kiszerelések, valamint többcélú, gyógyászati vagy állatgyógyászati felhasználásra egyaránt alkalmas, az EPO-utánzó kapocsmag utánzóanyagot gyógyászati szempontból elfogadható kiszerelésben tartalmazó tartósított kiszerelések képezik. A tartósított kiszerelések legalább egy ismert tartósítószert tartalmaznak, amely adott esetben a következõk legalább egyike: fenol, m¹krezol, p¹krezol, o¹krezol, klorokrezol, benzil-alkohol, fenil-higany-nitrit, fenoxietanol, formaldehid, klór-butanol, magnézium-klorid (például hexahidrát), alkilparaben (metil, etil, propil, butilparaben stb.), benzalkónium-klorid, benzetónium-klorid, nátrium-dehidroacetát, timerozál vagy mindezek vi- 17

18 1 4 0 zes oldószeres keverékei. A készítményekben bármely, szakember számára ismert koncentráció vagy keverék igénybe vehetõ 0,001 %¹os vagy ezek közötti bármely koncentrációértékben vagy ¹tartományban, amilyen például, de nem kizárólag a 0,001, 0,003, 0,00, 0,009, 0,01, 0,02, 0,03, 0,0, 0,09, 0,1, 0,2, 0,3, 0,4, 0,, 0,6, 0,7, 0,8, 0,9, 1,0, 1,1, 1,2, 1,3, 1,4, 1,, 1,6, 1,7, 1,8, 1,9, 2,0, 2,1, 2,2, 2,3, 2,4, 2,, 2,6, 2,7, 2,8, 2,9, 3,0, 3,1, 3,2, 3,3, 3,4, 3,, 3,6, 3,7, 3,8, 3,9, 4,0, 4,3, 4,, 4,6, 4,7, 4,8 vagy 4,9%. Nem korlátozó érvényû példák például a tartósítószer nélküli, illetve a következõ tartósítószereket tartalmazó készítmények: 0,1 2% m¹krezol (például 0,2, 0,3, 0,4, 0,, 0,9, 1,0%), 0,1 3% benzil-alkohol (például 0,, 0,9, 1,1, 1,, 1,9, 2,0, 2,%), 0,001 0,% timerozal (például 0,00, 0,01), 0,001 2,0% fenol (például 0,0, 0,, 0,28, 0,, 0,9, 1,0%), 0,000 1,0% alkilparaben (például 0,0007, 0,0009, 0,001, 0,002, 0,00, 0,007, 0,009, 0,01, 0,02, 0,0, 0,07, 0,09, 0,1, 0,2, 0,3, 0,, 0,7, 0,9, 1,0%) stb. Amint a fentiekbõl kitûnik, a találmány tárgyát csomagolóanyagot és az EPO-utánzó kapocsmag utánzóanyagot az elõírt pufferekkel és/vagy tartósítószerekkel, adott esetben vizes oldószerrel együtt tartalmazó oldatot magában foglaló edényt tartalmazó gyártmány képezi, amelyben a csomagolóanyagban lévõ címkén fel van tüntetve, hogy az oldat 1, 2, 3,4,, 6, 9, 12, 18,, 24,, 36,, 48, 4,, 66, 72 óráig vagy tovább tartható el. A találmány tárgyát képezi továbbá egy gyártmány, amely csomagolóanyagot és liofilizált EPOutánzó kapocsmag utánzóanyagot tartalmazó elsõ tárolóedényt és az elõírt puffert vagy tartósítószert magában foglaló vizes oldószert tartalmazó második tárolóedényt tartalmaz, ahol a csomagolóanyagban lévõ címke a páciens számára az EPO-utánzó kapocsmag utánzóanyag vagy annak meghatározott része vagy variánsa vizes oldatban történõ helyreállítására (rekonstituálására) ad utasítást, amely oldat elkészítve 24 órán keresztül vagy tovább is eltartható. A találmány szerinti módon alkalmazott EPO-utánzó kapocsmag utánzóanyag rekombináns úton emlõssejtekbõl vagy transzgenikus preparátumokból, vagy találmány szerinti vagy szakember számára ismert egyéb biológiai forrásokból állítható elõ. Az EPO-utánzó kapocsmag utánzóanyag vagy specifikus része, vagy variánsa találmány szerinti termékben foglalt mennyisége száraz/nedves rendszer esetében helyreállítás után körülbelül 1,0 g/ml-tõl körülbelül 00 mg/ml¹ig terjed, bár alacsonyabb és magasabb koncentrációk is mûködõképesek lehetnek, mindez a bejuttatásra igénybe venni kívánt vehikulum függvénye, például az oldatkiszerelések transzdermális tapasz, pulmonáris, nyálkahártyán át történõ, ozmotikus vagy mikropumpás eljárások esetében eltérõek. A vizes oldószer elõnyösen gyógyászati szempontból elfogadható tartósítószert is tartalmaz. Elõnyösnek tekintett tartósítószer a következõk bármelyike: fenol, m¹krezol, p¹krezol, o¹krezol, klorokrezol, benzil-alkohol, alkilparaben (metil, etil, propil, butilparaben stb.), benzalkónium-klorid, benzetónium-klorid, nátrium-dehidroacetát, timerozál vagy mindezek keverékei. A kiszerelésben alkalmazott tartósítószer koncentrációja az antimikrobiális hatás kifejtéséhez szükséges koncentrációval egyezik meg. A koncentráció a kiválasztott tartósítószer függvénye, megállapítása gyakorlott szakember számára nem okoz nehézséget. Adott esetben elõnyösen az oldószerhez keverhetõk egyéb vehikulumok, például izotóniát biztosító ágensek, pufferek, antioxidánsok, tartósítást fokozó szerek. Izotóniát biztosító ágenst, például glicerint gyakran alkalmaznak ismert koncentrációkban. A jobb ph¹szabályozás érdekében elõnyösen élettani szempontból tolerált puffer hozzáadására is sor kerül. A kiszerelések ph¹értéke széles határok között változhat, például körülbelül ph=4 és körülbelül ph= között, elõnyösen a ph¹tartomány körülbelül ph= és körülbelül ph=9 közötti, legelõnyösebben pedig körülbelül ph=6,0 és körülbelül ph=8,0 közötti. A találmány szerinti kiszerelések ph¹értéke elõnyösen körülbelül ph=6,8 és körülbelül ph=7,8 közötti. Elõnyösnek tekintett pufferek például a foszfátpufferek, a legelõnyösebb a nátrium-foszfát, különösen a foszfátpufferelt sóoldat (PBS). Az aggregáció mérséklése céljából a kiszerelésekhez vagy készítményekhez adott esetben további adalékanyagok, mint például gyógyászati szempontból elfogadható oldásgyorsító szerek, például Tween (poli(oxi-etilén) () szorbitán monolaurát), Tween (poli(oxi-etilén) () szorbitán monopalmitát), Tween 80 (poli(oxi-etilén) () szorbitán monooleát), Pluronic F69 (poli(oxi-etilén) polioxi-propilén blokk-kopolimer), valamint PEG (polietilénglikol) vagy nemionos szörfaktánsok, mint például poliszorbát vagy 80, vagy poloxamer 184 vagy 188, Pluronic poliolok, egyéb blokkkopolimerek, valamint kelátképzõ anyagok, például EDTA és EGTA adhatók. Ezek az adalék anyagok különösen hasznosak, ha a kiszerelés beadása pumpa vagy mûanyag tárolóedény alkalmazásával történik. A gyógyászati szempontból elfogadható szörfaktáns jelenléte csökkenti a protein aggregációs készségét. A találmány szerinti kiszerelések elõállíthatók az EPO-utánzó kapocsmag utánzóanyag és a következõ tartósítószerek bármelyikének vizes oldószerben történõ összekeverését alkalmazó folyamattal: fenol, m¹krezol, p¹krezol, o¹krezol, klorokrezol, benzil-alkohol, alkilparaben (metil, etil, propil, butilparaben stb.), benzalkónium-klorid, benzetónium-klorid, nátrium-dehidroacetát, timerozál vagy mindezek keverékei. Az EPOutánzó kapocsmag utánzóanyag és a tartósítószer vizes oldószerben történõ összekeverése hagyományos oldási és keverési eljárásokkal valósítható meg. Megfelelõ kiszerelés elõállítása érdekében például pufferelt oldatban lévõ megmért mennyiségû EPO-utánzó kapocsmag utánzóanyag és pufferelt oldatban lévõ kívánt tartósítószer olyan mennyiségeit keverjük össze, amelyek a protein és a tartósítószer kívánt koncentrációját biztosítják. Átlagosan képzett szakember számára nyilvánvalóak az említett folyamat lehetséges változatai. Például az összetevõk hozzáadásának sorrendje, a további adalék anyagok használata, a kiszerelés elõállí- 18

19 tásához alkalmazott hõmérséklet és ph mind olyan faktorok, amelyek az adott koncentráció és beadási mód figyelembevételével optimalizálhatók. A találmány szerinti kiszerelések tiszta oldatként vagy kettõs tárolóedényben biztosíthatók a páciensnek, utóbbiak közül az elsõ liofilizált EPO-utánzó kapocsmag utánzóanyagot tartalmaz, a másikban ennek helyreállítására szolgáló víz, tartósítószer és/vagy vehikulumok, elõnyösen foszfátpuffer és/vagy fiziológiás sóoldat található vizes oldószerben. A különálló oldatot tartalmazó tárolóedény vagy a helyreállítást igénylõ kettõs tárolóedény egyaránt többször is újra felhasználható, egy páciens egyszeri vagy többszöri kezelési ciklusára elegendõ lehet, így a jelenlegieknél kényelmesebb kezelési elrendezést biztosít. A találmány szerinti gyártmányok azonnali vagy huszonnégy óra múlva, vagy még késõbb történõ beadásra alkalmazhatók. Ennek megfelelõen a találmány szerinti gyártmányok lényeges elõnyöket jelentenek a páciens számára. A találmány szerinti kiszerelések adott esetben biztonsággal tárolhatók körülbelül 2 C és körülbelül C közötti hõmérsékleten, és hosszú ideig megtartják a protein biológiai aktivitását, így a csomagolócímkén feltüntethetõ, hogy az oldat 6, 12, 18, 24, 36, 48, 72 vagy 96 órán keresztül vagy tovább tárolható és/vagy felhasználható. Ha tartósítószert tartalmazó oldószer alkalmazására kerül sor, a címkén feltüntethetõ felhasználhatósági idõ 1 12 hónap, fél¹, másfél és/vagy két év. A találmány szerinti EPO-utánzó kapocsmag utánzóanyag oldatai elõállíthatók az EPO-utánzó kapocsmag utánzóanyag vizes oldószerben történõ keverését tartalmazó folyamattal. A keveréshez hagyományos oldási és keverési eljárások vehetõk igénybe. Megfelelõ oldószer elõállítása érdekében például vízben vagy pufferelt oldatban lévõ megmért mennyiségû EPOutánzó kapocsmag utánzóanyag vagy meghatározott része vagy variánsa olyan mennyiségeit keverjük össze, amelyek a protein és adott esetben a tartósítószer vagy puffer kívánt koncentrációját biztosítják. Átlagosan képzett szakember számára nyilvánvalóak az említett folyamat lehetséges változatai. Például az összetevõk hozzáadásának sorrendje, a további adalék anyagok használata, a kiszerelés elõállításához alkalmazott hõmérséklet és ph mind olyan faktorok, amelyek az adott koncentráció és beadási mód figyelembevételével optimalizálhatók. A találmány szerinti kiszerelések elõállíthatók az EPO-utánzó kapocsmag utánzóanyag egy kiválasztott pufferrel, elõnyösen fiziológiás sóoldatot vagy egy kiválasztott sót tartalmazó foszfátpufferrel történõ keverését tartalmazó folyamattal. Az EPO-utánzó kapocsmag utánzóanyag és a puffer vizes oldószerben történõ keveréshez hagyományos oldási és keverési eljárások vehetõk igénybe. Megfelelõ kiszerelés elõállítása érdekében például vízben vagy pufferelt oldatban lévõ megmért mennyiségû EPO-utánzó kapocsmag utánzóanyag és vizes oldatban lévõ kívánt pufferelõágens olyan mennyiségeit keverjük össze, amelyek a protein és a puffer kívánt koncentrációját biztosítják. Átlagosan képzett szakember számára nyilvánvalóak az említett folyamat lehetséges változatai. Például az összetevõk hozzáadásának sorrendje, a további adalék anyagok használata, a kiszerelés elõállításához alkalmazott hõmérséklet és ph mind olyan faktorok, amelyek az adott koncentráció és beadási mód figyelembevételével optimalizálhatók. A találmány szerinti, stabil vagy tartósított kiszerelésben vagy oldatban lévõ EPO-utánzó kapocsmag utánzóanyag számos beadási eljárással bejuttatható egy páciens szervezetébe, ilyenek a szubkután (SC) vagy intramuszkuláris (IM) injekció, a transzdermális beadás, a pulmonáris, a nyálkahártyán keresztül történõ, az implantátumban történõ, az ozmotikus pumpát alkalmazó, a kazettás, a mikropumpás vagy az egyéb, képzett szakember számára jól ismert egyéb módok. Gyógyászati alkalmazások A találmány tárgyát képezi a utánzóanyagok egy sejt, szövet, szerv, állat vagy páciens anémiájának módosítására vagy kezelésére szolgáló eljárásban történõ alkalmazása, amely anémia nem kizárólagosan a következõk bármelyike lehet: bármely eredetû anémia, rákkezeléshez kapcsolódó anémia, sugárkezeléshez vagy kemoterápiához kapcsolódó anémia, vírusos vagy bakteriális fertõzés kezeléséhez kapcsolódó anémia, veseeredetû anémia, koraszülöttséghez kapcsolódó anémia, gyermek- és/vagy felnõttkori rákhoz kapcsolódó anémia, limfómához, mielómához, mieloma multiplexhez kapcsolódó anémia, AIDS-hez kapcsolódó anémia, választott idõben történõ (elektív) mûtétre váró pácienseknek autológ véradás mellett vagy anélküli egyidejû kezelés, mûtétek preoperatív vagy posztoperatív szakaszában, autológ véradás vagy transzfúzió, perioperatív menedzsment, ciklikus neutropénia vagy Kostmann-szindróma (veleszületett agranulocitózis), végsõ stádiumú vesebetegség, dialízishez kapcsolódó anémia, idült veseelégtelenség, elsõdleges vérképzõszervi megbetegedések, így például veleszületett hipopláziás anémia, talasszémia major vagy sarlósejtes anémia, sarlósejtes anémia vérérelzáródásos komplikációi. Furman és munkatársai, Pediatrics 1992; 90: , Goldberg Science 1988; 242: ; Paul és munkatársai, Exp. Hematol. 1984; 12:8 8; Erslev és munkatársai, Arch. Intern. Med. 1968; 122:2 2; Ersley és munkatársai, Ann. Clin. Lab. Sci. 1980; :0 7; Jacobs és munkatársai, Nature 198; 313:806 8; Lin és munkatársai, Proc. Natl. Acad. Sci. USA 198; 82: ; Law és munkatársai, Proc. Natl. Acad. Sci. USA 1986; 83: ; Goldwasser és munkatársai, J. Biol. Chem. 1974; 249:42 46; Eaves és munkatársai, Blood 1978; 2: ; Sawyer és munkatársai, Blood 1989; 74:3 9; Winearls és munkatársai, Lancet 1986; 2: ; Eschbach és munkatársai, N. Engl. J. Med. 1987; 316: 73 78; Eschbach és munkatársai, Ann. Intern. Med. 1989; 111: A találmány szerinti utánzóanyagok nem veseeredetû anémiák esetében is alkalmazhatók, ilyenek például az idült fertõzések, a gyulladásos folyamatok, a 19

20 1 4 0 sugárterápia és a citosztatikus droggal végzett kezelés, nem veseeredetû anémiás páciensek kezelése során biztató eredményekrõl számoltak be. Lásd például Abels RI és Rudnick SA Eritropoietin: evolving clinical applications. Experimental Hematology 19: (1991); Graber SE és Krantz SB Eritropoietin: biology and clinical use. Hematology/Oncol. Clin. North Amer. 3:369 0 (1989); Jelkman W és Gross AJ (szerk.) Eritropoietin. Springer, Berlin 1989; Koury MJ és Bondurant MC The molecular mechanism of eritropoietin action. European Journal of Biochemistry 2: (1992); Krantz SB Eritropoietin. Blood 77: (1991); Tabbara IA Eritropoietin. Biology and clinical applications. Archives of Internal Medicine 13: (1993). A találmány tárgyát képezi továbbá a utánzóanyag sejt, szövet, szerv, állat vagy páciensbeli anémia vagy vérsejtekkel kapcsolatos állapot módosítására vagy kezelésére történõ alkalmazása, ahol az anémia vagy vérsejtekkel kapcsolatos állapot többek között, de nem kizárólag a következõk bármelyike: immunológiai eredetû betegség, szív-érrendszeri betegség, fertõzõ, malignus és/vagy neurológiai betegség. Ez az eljárás adott esetben magában foglalja az EPO-utánzó kapocsmag utánzóanyagot tartalmazó legalább egy készítmény vagy gyógyászati készítmény hatékony mennyiségének ilyen módosítást, kezelést vagy terápiát igénylõ sejt, szövet, szerv vagy páciens részére történõ beadását. A találmány tárgyát képezi továbbá a utánzóanyag sejt, szövet, szerv, állat vagy páciens daganatos/fertõzõ betegségének módosítására vagy kezelésére történõ alkalmazása, ahol a betegség többek között, de nem kizárólag a következõk bármelyike lehet: heveny vagy idült bakteriális fertõzés, heveny vagy idült parazitás vagy fertõzõ folyamat, ideértve a bakteriális, vírusos és gombás fertõzéseket, HIV-fertõzés/HIV-neuropátia, meningitisz, hepatitisz, szeptikus artritisz, peritonitisz, pneumónia, epiglottitisz, E. coli O17:H7 (fertõzés), hemolitikus urémiás szindróma/trombolitikus trombocitopéniás purpura, malária, dengue vérzéses láz, leishmaniázis, lepra, toxikus sokk szindróma, streptococcusos miozitisz, gázgangréna, Mycobacterium tuberculosis (fertõzés), Mycobacterium avium intracellulare (fertõzés), Pneumocystis carinii pneumónia, medencei gyulladásos megbetegedés, orchitis/epidydimitis, Legionella (fertõzés), Lyme-kór, influenza A (vírusfertõzés), Epstein Barr-vírus (fertõzés), vírusfertõzéshez kapcsolódó hemofagocitózisos szindróma, vírusos encefalitisz/aszeptikus meningitisz stb.; (ii) leukémia, akut leukémia, akut limfoblasztos leukémia (ALL), B¹sejtes, T¹sejtes vagy FAB ALL, akut mieloid leukémia (AML), krónikus mielocitás leukémia (CML), krónikus limfocitás leukémia (CLL), hajas sejtes leukémia, mielodiszpláziás szindróma (MDS) limfóma, Hodgkin-kór, malignus limfóma, nem-hodgkin limfóma, Burkitt limfóma, mieloma multiplex, Kaposi-szarkóma, kolorektális karcinóma, hasnyálmirigy-karcinóma, nazofaringeális karcinóma, malignus hisztiocitózis, paraneoplasztikus szindróma/malignitáshoz kapcsolódó hiperkalcémia, szolid tumorok, adenokarcinómák, szarkómák, malignus melanoma stb., vagy (iii) neurodegeneratív megbetegedések, szklerózis multiplex, migrénes fejfájás, AIDS demencia komplex, demielinizációval járó betegségek, mint például szklerózis multiplex és heveny transzverz mielitisz, extrapiramidális és cerebelláris rendellenességek, mint például a kortikospinális rendszer elváltozásai, a bazális ganglionok rendellenességei vagy cerebelláris rendellenességek, hiperkinetikus mozgászavarok, mint például a Huntington-féle chorea és az idõskori chorea, drog elõidézte mozgászavarok, így például a CNS dopaminreceptorait blokkoló drogok által kiváltott kórképek; hipokinetikus mozgászavarok, amilyen például a Parkinson-kór, a progresszív szupranukleáris bénulás, a kisagy strukturális sérülései, spinocerebelláris degenerációk, mint például spinális ataxia, Friedrich-féle ataxia, cerebelláris kortikális degenerációk, több rendszerre kiterjedõ degenerációk (Mencel¹, Dejerine-Thomas¹, Shi-Drager- és Machado-Joseph-féle degeneráció); szisztémás rendellenességek (Refsum-kór, abétalipoproteinémia, ataxia, teleangiektázia és mitokondriális multiszisztémás rendellenesség); demielinizációval járó magbetegségek, például szklerózis multiplex, heveny transzverz mielitisz; a mozgatóegység rendellenességei, például neurogén izomatrófiák (elülsõ szarvbeli sejtdegeneráció, például amiotrófiás laterális szklerózis, infantilis spinális izomatrófia és juvenilis spinális izomatrófia); Alzheimer-kór, középkorúak Down-szindrómája, diffúz Lewy-testes betegség, Lewy-testes idõskori demencia, Wernicke Korsakoff-szindróma, idült alkoholizmus, Creutzfeldt Jakob-betegség; szubakut szklerotizáló panencefalitisz, Hallerrorden Spatz-betegség, dementia pugilistica stb. Ez az eljárás adott esetben magában foglalhatja legalább egy TNF-ellenanyagot vagy annak meghatározott részét, vagy változatát tartalmazó készítmény vagy gyógyászati készítmény hatékony mennyiségének ilyen módosítást, kezelést vagy terápiát igénylõ sejt, szövet, szerv vagy páciens részére történõ beadását. Lásd például Merck Manual, 16. kiadás, Merck & Company, Rahway, NJ (1992). Ez az eljárás adott esetben magában foglalja az EPO-utánzó kapocsmag utánzóanyagot tartalmazó legalább egy készítmény vagy gyógyászati készítmény hatékony mennyiségének ilyen módosítást, kezelést vagy terápiát igénylõ sejt, szövet, szerv vagy páciens részére történõ beadását. A találmány tárgyát képezi továbbá a utánzóanyag legalább egy kardiovaszkuláris megbetegedés sejt¹, szövet¹, szerv¹, állat- vagy páciensbeli módosítására vagy kezelésére történõ alkalmazása, amely megbetegedés például, de nem kizárólag az alábbiak bármelyike lehet: cardiac stun szindróma, szívizominfarktus, pangásos szívelégtelenség, stroke, isémiás stroke, vérzés, arterioszklerózis, ateroszklerózis, diabéteszhez társuló arterioszklerotikus megbetegedés, magas vérnyomás, artériás magas vérnyomás, veseér-eredetû magas vérnyomás, szinkópe, sokk, kardiovaszkuláris szifilisz, szívelégtelenség, cor pulmonale, elsõdleges pulmonáris magas vérnyomás, szívaritmiák, pitvari ek-


(11) Lajstromszám: E 008 257 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000827T2! (19) HU (11) Lajstromszám: E 008 27 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 727848 (22) A bejelentés


avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest

avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest Iparilag alkalmazható szekvenciák, avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest Neutrokin α - jelentős kereskedelmi érdekek



(11) Lajstromszám: E 008 532 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000832T2! (19) HU (11) Lajstromszám: E 008 32 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 783231 (22) A bejelentés



(11) Lajstromszám: E 008 370 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008370T2! (19) HU (11) Lajstromszám: E 008 370 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 750224 (22) A bejelentés



(11) Lajstromszám: E 007 751 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007751T2! (19) HU (11) Lajstromszám: E 007 751 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 810619 (22) A bejelentés napja:



(11) Lajstromszám: E 007 949 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007949T2! (19) HU (11) Lajstromszám: E 007 949 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 07 835738 (22) A bejelentés napja:



(11) Lajstromszám: E 005 570 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000070T2! (19) HU (11) Lajstromszám: E 00 70 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 80947 (22) A bejelentés napja: 2006.


A preventív vakcináció lényege :

A preventív vakcináció lényege : Vakcináció Célja: antigénspecifkus immunválasz kiváltása a szervezetben A vakcina egy olyan készítmény, amely fokozza az immunitást egy adott betegséggel szemben (aktiválja az immunrendszert). A preventív


Klónozás: tökéletesen egyforma szervezetek csoportjának előállítása, vagyis több genetikailag azonos egyed létrehozása.

Klónozás: tökéletesen egyforma szervezetek csoportjának előállítása, vagyis több genetikailag azonos egyed létrehozása. Növények klónozása Klónozás Klónozás: tökéletesen egyforma szervezetek csoportjának előállítása, vagyis több genetikailag azonos egyed létrehozása. Görög szó: klon, jelentése: gally, hajtás, vessző. Ami



(11) Lajstromszám: E 006 472 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000006472T2! (19) HU (11) Lajstromszám: E 006 472 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 788982 (22) A bejelentés napja:



(11) Lajstromszám: E 007 384 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007384T2! (19) HU (11) Lajstromszám: E 007 384 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 757801 (22) A bejelentés napja:



(11) Lajstromszám: E (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007147T2! (19) HU (11) Lajstromszám: E 007 147 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 007068 (22) A bejelentés napja:


Molekuláris terápiák

Molekuláris terápiák Molekuláris terápiák Aradi, János Balajthy, Zoltán Csősz, Éva Scholtz, Beáta Szatmári, István Tőzsér, József Varga, Tamás Szerkesztette Balajthy, Zoltán és Tőzsér, József, Debreceni Egyetem Molekuláris



(11) Lajstromszám: E 004 263 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000004263T2! (19) HU (11) Lajstromszám: E 004 263 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 70014 (22) A bejelentés napja:



(11) Lajstromszám: E (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008262T2! (19) HU (11) Lajstromszám: E 008 262 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 725251 (22) A bejelentés napja:


Kereskedelmi forgalomban lévő rekombináns gyógyszerkészítmények

Kereskedelmi forgalomban lévő rekombináns gyógyszerkészítmények Kereskedelmi forgalomban lévő rekombináns gyógyszerkészítmények Írta: Barta Zsolt Biomérnök hallgató 2007 Tartalomjegyzék 1 Rekombináns inzulin [1]... 3 2 A humán növekedési hormon rekombináns módon történő



(11) Lajstromszám: E 003 868 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000003868T2! (19) HU (11) Lajstromszám: E 003 868 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 73619 (22) A bejelentés napja:


Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az



(11) Lajstromszám: E 003 866 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000003866T2! (19) HU (11) Lajstromszám: E 003 866 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 77829 (22) A bejelentés napja:



(11) Lajstromszám: E 007 952 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000792T2! (19) HU (11) Lajstromszám: E 007 92 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 73892 (22) A bejelentés napja:



(11) Lajstromszám: E 007 625 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000076T2! (19) HU (11) Lajstromszám: E 007 6 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 79689 (22) A bejelentés napja: 0.


(11) Lajstromszám: E 003 213 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA. (51) Int. Cl.: A01C 7/04 (2006.01)

(11) Lajstromszám: E 003 213 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA. (51) Int. Cl.: A01C 7/04 (2006.01) !HU000003213T2! (19) HU (11) Lajstromszám: E 003 213 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 005442 (22) A bejelentés napja:


Immunológia I. 4. előadás. Kacskovics Imre

Immunológia I. 4. előadás. Kacskovics Imre Immunológia I. 4. előadás Kacskovics Imre (imre.kacskovics@ttk.elte.hu) 3.1. ábra A vérsejtek képződésének helyszínei az élet folyamán 3.2. ábra A hemopoetikus őssejt aszimmetrikus osztódása 3.3. ábra



(11) Lajstromszám: E 005 557 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007T2! (19) HU (11) Lajstromszám: E 00 7 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 026690 (22) A bejelentés napja: 03.


Érvényesíteni csak pontosan, szépen. az európai szabadalmak fordításával kapcsolatos problémák

Érvényesíteni csak pontosan, szépen. az európai szabadalmak fordításával kapcsolatos problémák Érvényesíteni csak pontosan, szépen az európai szabadalmak fordításával kapcsolatos problémák A magyar különleges nyelv - áldás-e vagy átok? Aki dolgozik, hibázik is, vagyis A magyar különleges nyelv -


Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén

Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Dr. Dallmann Klára A molekuláris biológia célja az élőlények és sejtek működésének molekuláris szintű


Immunológia I. 2. előadás. Kacskovics Imre (imre.kacskovics@ttk.elte.hu)

Immunológia I. 2. előadás. Kacskovics Imre (imre.kacskovics@ttk.elte.hu) Immunológia I. 2. előadás Kacskovics Imre (imre.kacskovics@ttk.elte.hu) Az immunválasz kialakulása A veleszületett és az adaptív immunválasz összefonódása A veleszületett immunválasz mechanizmusai A veleszületett


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


Az Ig génátrendeződés

Az Ig génátrendeződés Az Ig génátrendeződés Háromféle változás játszódik le a molekula szerkezetét tekintve: B sejtek fejlődése alatt: VDJ átrendeződés (rekombináció) IgH izotípusváltás rekombináció (CSR) Szomatikus hipermutáció



TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL Az egyes biomolekulák izolálása kulcsfontosságú a biológiai szerepük tisztázásához. Az affinitás kromatográfia egyszerűsége, reprodukálhatósága



(11) Lajstromszám: E 006 499 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000006499T2! (19) HU (11) Lajstromszám: E 006 499 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 78626 (22) A bejelentés napja:


Biotechnológiai gyógyszergyártás

Biotechnológiai gyógyszergyártás Biotechnológiai gyógyszergyártás Dr. Greiner István 2013. november 6. Biotechnológiai gyógyszergyártás Biotechnológiai gyógyszerek Előállításuk és analitikájuk Richter és a biotechnológia Debrecen A jövő


Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői.

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői. Immunológia alapjai 3 4. előadás Az immunológiai felismerés molekuláris összetevői. Az antigén fogalma. Antitestek, T- és B- sejt receptorok: molekuláris szerkezet, funkciók, alcsoportok Az antigén meghatározása



(11) Lajstromszám: E 004 313 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000004313T2! (19) HU (11) Lajstromszám: E 004 313 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 771807 (22) A bejelentés napja:



(11) Lajstromszám: E 003 099 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000099T2! (19) HU (11) Lajstromszám: E 003 099 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 76424 (22) A bejelentés napja:


NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYGENETIKA Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 A NÖVÉNYI TÁPANYAG TRANSZPORTEREK az előadás áttekintése A tápionok útja a növényben Növényi tápionok passzív és



(11) Lajstromszám: E 005 012 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000012T2! (19) HU (11) Lajstromszám: E 00 012 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 0124 (22) A bejelentés napja: 03.



(11) Lajstromszám: E 005 564 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000064T2! (19) HU (11) Lajstromszám: E 00 64 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 704342 (22) A bejelentés napja: 0.


DER (Felületén riboszómák találhatók) Feladata a biológiai fehérjeszintézis Riboszómák. Az endoplazmatikus membránrendszer. A kódszótár.

DER (Felületén riboszómák találhatók) Feladata a biológiai fehérjeszintézis Riboszómák. Az endoplazmatikus membránrendszer. A kódszótár. Az endoplazmatikus membránrendszer Részei: DER /durva (szemcsés) endoplazmatikus retikulum/ SER /sima felszínű endoplazmatikus retikulum/ Golgi készülék Lizoszómák Peroxiszómák Szekréciós granulumok (váladékszemcsék)



(11) Lajstromszám: E 008 612 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008612T2! (19) HU (11) Lajstromszám: E 008 612 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 76412 (22) A bejelentés


TÉMAKÖRÖK. Ősi RNS világ BEVEZETÉS. RNS-ek tradicionális szerepben



Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 7. előadás Immunizálás. Poliklonális és monoklonális ellenanyag előállítása, tisztítása, alkalmazása Az antigén (haptén + hordozó) sokféle specificitású ellenanyag



(11) Lajstromszám: E 005 409 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000009T2! (19) HU (11) Lajstromszám: E 00 9 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 791698 (22) A bejelentés napja: 03.


Biológiai biztonság: Veszély: - közvetlen - közvetett

Biológiai biztonság: Veszély: - közvetlen - közvetett Biológiai biztonság Biológiai biztonság: Minden biológiai anyag potenciálisan kórokozó és szennyező; a biológiai biztonság ezen biológiai anyagok hatásaira (toxikus hatások, fertőzések) koncentrál és célja


Az ellenanyagok orvosbiológiai. PhD kurzus 2011/2012 II. félév

Az ellenanyagok orvosbiológiai. PhD kurzus 2011/2012 II. félév Az ellenanyagok orvosbiológiai alkalmazása PhD kurzus 2011/2012 II. félév Ellenanyagok előállítása, tisztítása, jelölése, fragmentálása Monoklonális vs. poliklonális ellenanyagok Ellenanyagok előállítása


MUTÁCIÓK. A mutáció az örökítő anyag spontán, maradandó megváltozása, amelynek során új genetikai tulajdonság keletkezik.

MUTÁCIÓK. A mutáció az örökítő anyag spontán, maradandó megváltozása, amelynek során új genetikai tulajdonság keletkezik. MUTÁCIÓK A mutáció az örökítő anyag spontán, maradandó megváltozása, amelynek során új genetikai tulajdonság keletkezik. Pontmutáció: A kromoszóma egy génjében pár nukleotidnál következik be változás.



(11) Lajstromszám: E 004 705 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000470T2! (19) HU (11) Lajstromszám: E 004 70 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 81479 (22) A bejelentés napja: 0.


3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció



(11) Lajstromszám: E 005 730 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000005730T2! (19) HU (11) Lajstromszám: E 005 730 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 741052 (22) A bejelentés napja:



(11) Lajstromszám: E 004 563 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000463T2! (19) HU (11) Lajstromszám: E 004 63 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 749820 (22) A bejelentés napja:


Génátvitel magasabb rendű állatokba elméleti megfontolások, gyakorlati eredmények és génterápiás lehetőségek

Génátvitel magasabb rendű állatokba elméleti megfontolások, gyakorlati eredmények és génterápiás lehetőségek MEZÕGAZDASÁGI BIOTECHNOLÓGIÁK Génátvitel magasabb rendű állatokba elméleti megfontolások, gyakorlati eredmények és génterápiás lehetőségek Tárgyszavak: génátvitel; transzfekció; transzgenézis; génterápia;


Biomolekuláris nanotechnológia. Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium

Biomolekuláris nanotechnológia. Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium Biomolekuláris nanotechnológia Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium Az élő szervezetek példája azt mutatja, hogy a fehérjék és nukleinsavak kiválóan alkalmasak önszerveződő molekuláris


Hatékony tumorellenes készítmények előállítása target és drug molekulák kombinációjával (Zárójelentés)

Hatékony tumorellenes készítmények előállítása target és drug molekulák kombinációjával (Zárójelentés) Hatékony tumorellenes készítmények előállítása target és drug molekulák kombinációjával (Zárójelentés) Prof. Dr. Mező Gábor tudományos tanácsadó Kutatásunk célja az volt, hogy olyan biokonjugátumokat készítsünk,


RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek

RNS-ek. 1. Az ősi RNS Világ: - az élet hajnalán. 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek RNS-ek RNS-ek 1. Az ősi RNS Világ: - az élet hajnalán 2. Egy már ismert RNS Világ: - a fehérjeszintézis ben résztvevő RNS-ek 3. Egy újonnan felfedezett RNS Világ: - szabályozó RNS-ek 4. Transzkripció Ősi



HUMAN IMMUNODEFICIENCY VIRUS (HIV) ÉS AIDS HUMAN IMMUNODEFICIENCY VIRUS (HIV) ÉS AIDS Dr. Mohamed Mahdi MD. MPH. Department of Infectology and Pediatric Immunology University of Debrecen 2010 Történelmi tények a HIV-ről 1981: Első megjelenés San



(11) Lajstromszám: E 008 015 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008015T2! (19) HU (11) Lajstromszám: E 008 015 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 778847 (22) A bejelentés napja:


A replikáció mechanizmusa

A replikáció mechanizmusa Az öröklődés molekuláris alapjai A DNS megkettőződése, a replikáció Szerk.: Vizkievicz András A DNS-molekula az élőlények örökítő anyaga, kódolt formában tartalmazza mindazon információkat, amelyek a sejt,


A géntechnikák alkalmazási területei leltár. Géntechnika 3. Dr. Gruiz Katalin

A géntechnikák alkalmazási területei leltár. Géntechnika 3. Dr. Gruiz Katalin A géntechnikák alkalmazási területei leltár Géntechnika 3 Dr. Gruiz Katalin Kutatás Genetikai: genomok feltérképezése: HUGO, mikroorganizmusoké, ujjlenyomatok készítése, jellegzetes szekvenciák keresése



(11) Lajstromszám: E 005 087 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000087T2! (19) HU (11) Lajstromszám: E 00 087 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 76909 (22) A bejelentés napja: 0.


(11) Lajstromszám: E (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA. (51) Int. Cl.: A01C 7/04 ( )

(11) Lajstromszám: E (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA. (51) Int. Cl.: A01C 7/04 ( ) !HU000003148T2! (19) HU (11) Lajstromszám: E 003 148 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 005441 (22) A bejelentés napja:


5. Molekuláris biológiai technikák

5. Molekuláris biológiai technikák 5. Molekuláris biológiai technikák DNS szaporítás kémcsőben és élőben. Klónozás, PCR, cdna, RT-PCR, realtime-rt-pcr, Northern-, Southernblotting, génexpresszió, FISH 5. Molekuláris szintű biológiai technikák



ANTICANCER RESEARCH [Rákkutatás] ANTICANCER RESEARCH [Rákkutatás] Nemzetközi rákkutatási és rákgyógyászati folyóirat Az MGN-3/Biobran rizskorpából kivont módosított arabinoxilán in vitro növeli a metasztatikus emlőráksejtek érzékenységét


4. A humorális immunválasz október 12.

4. A humorális immunválasz október 12. 4. A humorális immunválasz 2016. október 12. A klónszelekciós elmélet sarokpontjai: Monospecifictás: 1 sejt 1-féle specificitású receptor Az antigén receptorhoz kötődése aktiválja a limfocitát A keletkező



(11) Lajstromszám: E 005 510 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000010T2! (19) HU (11) Lajstromszám: E 00 10 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 769233 (22) A bejelentés napja: 2004.



2.6.16. VIZSGÁLATOK IDEGEN KÓROKOZÓKRA HUMÁN ÉLŐVÍRUS-VAKCINÁKBAN 2.6.16. Vizsgálatok idegen kórokozókra Ph.Hg.VIII. - Ph.Eur.7.0 1 2.6.16. VIZSGÁLATOK IDEGEN KÓROKOZÓKRA HUMÁN ÉLŐVÍRUS-VAKCINÁKBAN 01/2011:20616 Azokhoz a vizsgálatokhoz, amelyekhez a vírust előzőleg



(11) Lajstromszám: E 004 311 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000004311T2! (19) HU (11) Lajstromszám: E 004 311 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 729 (22) A bejelentés napja:



(11) Lajstromszám: E 008 464 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000008464T2! (19) HU (11) Lajstromszám: E 008 464 (13) T2 MAGYAR KÖZTÁRSASÁG Szellemi Tulajdon Nemzeti Hivatala EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 05 787786 (22) A bejelentés



(11) Lajstromszám: E 006 915 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000691T2! (19) HU (11) Lajstromszám: E 006 91 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 7137 (22) A bejelentés napja: 04.



(11) Lajstromszám: E 006 966 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000006966T2! (19) HU (11) Lajstromszám: E 006 966 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 717644 (22) A bejelentés napja:


Hamar Péter. RNS világ. Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. www.meetthescientist.hu 1 26

Hamar Péter. RNS világ. Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. www.meetthescientist.hu 1 26 Hamar Péter RNS világ Lánczos Kornél Gimnázium, Székesfehérvár, 2014. október 21. 1 26 Főszereplők: DNS -> RNS -> fehérje A kód lefordítása Dezoxy-ribo-Nuklein-Sav: DNS az élet kódja megkettőződés (replikáció)



(11) Lajstromszám: E 006 093 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000093T2! (19) HU (11) Lajstromszám: E 006 093 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 749886 (22) A bejelentés napja:



(11) Lajstromszám: E 007 504 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007504T2! (19) HU (11) Lajstromszám: E 007 504 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 07 020400 (22) A bejelentés napja:


Mikrobiális antigének

Mikrobiális antigének Mikrobiális antigének Dr. Pusztai Rozália SZTE, ÁOK, Orvosi Mikrobiológiai és Immunbiológiai Intézet 2008. november 17. Antigének Konvencionális antigének Superantigének Antigén - az érett immunrendszer


BIOTECHNOLÓGIÁK EGYÉB IPARÁGAKBAN. Pókselyemfehérjék előállítása dohányban és burgonyában

BIOTECHNOLÓGIÁK EGYÉB IPARÁGAKBAN. Pókselyemfehérjék előállítása dohányban és burgonyában BIOTECHNOLÓGIÁK EGYÉB IPARÁGAKBAN Pókselyemfehérjék előállítása dohányban és burgonyában Tárgyszavak: selyemfehérje; transzgénikus növény; szintetikus pókselyem; selyemfehérjegén. A Nephila clavipes pók


Transzgénikus. nikus állatok. Transzgénikus nikus minden olyan állat, melynek genomja emberi közremk bejuttatott DNS-t t tartalmaz.

Transzgénikus. nikus állatok. Transzgénikus nikus minden olyan állat, melynek genomja emberi közremk bejuttatott DNS-t t tartalmaz. Transzgénikus nikus állatok Transzgénikus nikus minden olyan állat, melynek genomja emberi közremk zremüködéssel bejuttatott DNS-t t tartalmaz. I. A KONKRÉT T GÉNSEBG NSEBÉSZETI SZETI TECHNIKA A beavatkozást


Poligénes v. kantitatív öröklődés

Poligénes v. kantitatív öröklődés 1. Öröklődés komplexebb sajátosságai 2. Öröklődés molekuláris alapja Poligénes v. kantitatív öröklődés Azok a tulajdonságokat amelyek mértékegységgel nem, vagy csak nehezen mérhetők, kialakulásuk kevéssé


Mit tud a genetika. Génterápiás lehetőségek MPS-ben. Dr. Varga Norbert

Mit tud a genetika. Génterápiás lehetőségek MPS-ben. Dr. Varga Norbert Mit tud a genetika Génterápiás lehetőségek MPS-ben Dr. Varga Norbert Oki terápia Terápiás lehetőségek MPS-ben A kiváltó okot gyógyítja meg ERT Enzimpótló kezelés Őssejt transzplantáció Genetikai beavatkozások



CIÓ A GENETIKAI INFORMÁCI A DNS REPLIKÁCI A GENETIKAI INFORMÁCI CIÓ TÁROLÁSA ÉS S KIFEJEZŐDÉSE A DNS SZERKEZETE Két antiparalel (ellentétes lefutású) polinukleotid láncból álló kettős helix A két lánc egy képzeletbeli közös tengely körül van feltekeredve,



(11) Lajstromszám: E 008 254 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000824T2! (19) HU (11) Lajstromszám: E 008 24 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 791108 (22) A bejelentés napja:



(11) Lajstromszám: E 005 805 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000080T2! (19) HU (11) Lajstromszám: E 00 80 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 7361 (22) A bejelentés napja: 06.


Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására

Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására Szalma Katalin Biológiai módszerek alkalmazása környezeti hatások okozta terhelések kimutatására Témavezető: Dr. Turai István, OSSKI Budapest, 2010. október 4. Az ionizáló sugárzás sejt kölcsönhatása Antone



(11) Lajstromszám: E 005 094 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000005094T2! (19) HU (11) Lajstromszám: E 005 094 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 03 797487 (22) A bejelentés napja:



(11) Lajstromszám: E 006 234 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000006234T2! (19) HU (11) Lajstromszám: E 006 234 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 06 700417 (22) A bejelentés napja:


A basidiomycota élesztőgomba, a Filobasidium capsuligenum IFM 40078 törzse egy olyan

A basidiomycota élesztőgomba, a Filobasidium capsuligenum IFM 40078 törzse egy olyan A basidiomycota élesztőgomba, a Filobasidium capsuligenum IFM 40078 törzse egy olyan fehérjét (FC-1 killer toxint) választ ki a tápközegbe, amely elpusztítja az opportunista patogén Cryptococcus neoformans-t.


Molekuláris biológiai technikák

Molekuláris biológiai technikák Molekuláris biológiai technikák Wunderlich Lívius A Molekuláris biológiai technikák jegyzet igyekszik átfogó képet adni a jövő tudományának, a molekuláris biológiának a módszertanáról. A technikák elméleti


A PET szerepe a gyógyszerfejlesztésben. Berecz Roland DE KK Pszichiátriai Tanszék

A PET szerepe a gyógyszerfejlesztésben. Berecz Roland DE KK Pszichiátriai Tanszék A PET szerepe a gyógyszerfejlesztésben Berecz Roland DE KK Pszichiátriai Tanszék Gyógyszerfejlesztés Felfedezés gyógyszertár : 10-15 év Kb. 1 millárd USD/gyógyszer (beleszámolva a sikertelen fejlesztéseket)



A BIZOTTSÁG 2009/120/EK IRÁNYELVE 2009.9.15. Az Európai Unió Hivatalos Lapja L 242/3 IRÁNYELVEK A BIZOTTSÁG 2009/120/EK IRÁNYELVE (2009. szeptember 14.) a fejlett terápiás gyógyszerkészítmények tekintetében az emberi felhasználásra szánt


A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános

A sejtek élete. 5. Robotoló törpék és óriások Az aminosavak és fehérjék R C NH 2. C COOH 5.1. A fehérjeépítőaminosavak általános A sejtek élete 5. Robotoló törpék és óriások Az aminosavak és fehérjék e csak nézd! Milyen protonátmenetes reakcióra képes egy aminosav? R 2 5.1. A fehérjeépítőaminosavak általános képlete 5.2. A legegyszerűbb


A géntechnológia genetikai alapjai (I./3.)

A géntechnológia genetikai alapjai (I./3.) Az I./2. rész (Gének és funkciójuk) rövid összefoglalója A gének a DNS információt hordozó szakaszai, melyekben a 4 betű (ATCG) néhány ezerszer, vagy százezerszer ismétlődik. A gének önálló programcsomagként



(11) Lajstromszám: E 007 800 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000007800T2! (19) HU (11) Lajstromszám: E 007 800 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 0 787403 (22) A bejelentés napja:



(11) Lajstromszám: E 006 710 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU0000067T2! (19) HU (11) Lajstromszám: E 006 7 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 731277 (22) A bejelentés napja: 04.





Az adenovírusok morfológiája I.

Az adenovírusok morfológiája I. Adenovírusok A vírusok Elnevezésük a latin virus szóból ered, amelynek jelentése méreg. A vírusok a legkisebb ismert entitások. Csak elektronmikroszkóppal tanulmányozhatóak, mert méretük 20-400 nanométerig


tárgyú találmányok szabadalmaztatásában

tárgyú találmányok szabadalmaztatásában Szakmai Rendezvény a Szellemi Tulajdon Világnapja Tiszteletére 2011. április 27. Különlegességek és aktualitások a biotechnológiai tárgyú találmányok szabadalmaztatásában Dr. Pethő Árpád szabadalmi bdl



(11) Lajstromszám: E 004 725 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000472T2! (19) HU (11) Lajstromszám: E 004 72 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 7372 (22) A bejelentés napja: 04.



(11) Lajstromszám: E 008 154 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU00000814T2! (19) HU (11) Lajstromszám: E 008 14 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 04 81727 (22) A bejelentés napja:


17.2. ábra Az immunválasz kialakulása és lezajlása patogén hatására

17.2. ábra Az immunválasz kialakulása és lezajlása patogén hatására 11. 2016. nov 30. 17.2. ábra Az immunválasz kialakulása és lezajlása patogén hatására 17.3. ábra A sejtközötti térben és a sejten belül élő és szaporodó kórokozók ellen kialakuló védekezési mechanizmusok



(11) Lajstromszám: E 005 744 (13) T2 EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA !HU000005744T2! (19) HU (11) Lajstromszám: E 005 744 (13) T2 MAGYAR KÖZTÁRSASÁG Magyar Szabadalmi Hivatal EURÓPAI SZABADALOM SZÖVEGÉNEK FORDÍTÁSA (21) Magyar ügyszám: E 05 775757 (22) A bejelentés napja:



ENZIMEK BIOTECHNOLÓGIAI ELŐÁLLÍTÁSA Az élettudományi-klinikai felsőoktatás gyakorlatorientált és hallgatóbarát korszerűsítése a vidéki képzőhelyek nemzetközi versenyképességének erősítésére TÁMOP-4.1.1.C-13/1/KONV-2014-0001 ENZIMEK BIOTECHNOLÓGIAI


Hatóanyag vs. adjuváns/excipiens. Avagy miért nem hatóanyag egy ható anyag?

Hatóanyag vs. adjuváns/excipiens. Avagy miért nem hatóanyag egy ható anyag? Hatóanyag vs. adjuváns/excipiens Avagy miért nem hatóanyag egy ható anyag? A kérdések A kezdetek C-431/04 MIT A gyógyszer hatóanyag-kombinációja fogalom megköveteli-e, hogy a kombináció alkotórészei mind
