1. Multigénes markerek. 3. Problémák BEVEZETŐ. ER/PGR-státusz meghatározása. Exonszinten

Save this PDF as:
 WORD  PNG  TXT  JPG

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "1. Multigénes markerek. 3. Problémák BEVEZETŐ. ER/PGR-státusz meghatározása. Exonszinten"

Átírás

1 BEVEZETŐ Tumorprogresszió és előrejelzése Dr. Győrffy Balázs Áttekintő 1. Multigénes markerek 1. Módszerek 2. Indikáció: Ismeretlen eredetű tumor Emlőrák 3. Problémák 2. Bioinformatika Közös gének génlistákban Egy gén Transzkripció szabályozása Meta-analízisek BEVEZETŐ Előnyök Multigénes markerek Multigénes folyamat több gén egyszerre! 3 patológus által adott tumor grade: 50%-os egyezés unbiased screening = meglévő tudás nem befolyásolja Módszerek #1/3 - technológia Minta FFPE FFPE Morfológia alapú Gének száma Szemi (S)-/ (Q)kvantitatív IHC FISH RT-PCR Microarray RNA-seq FFPE/ fagyasztott Fagyasztott Fagyasztott Igen Igen Nem Nem Nem Kicsi Kicsi Közepes Nagy (exonszinten) Exonszinten S S Q Q Q Statisztika Egyszerű Egyszerű Komplex Nagyon komplex Ultra komplex FDR ráta Kicsi Kicsi Közepes Nagy? BEVEZETŐ Módszerek #2/3 - felhasználás ER/PGR-státusz meghatározása IHC FISH RT-PCR Microarray Igen* Nem Igen Igen HER-2 státusz Igen* Igen* Igen Igen KEMO válasz Nem Nem Igen* Igen* Kezelés toxicitás meghatározása *klinikai alkalmazásban Nem Nem Nem Nem BEVEZETŐ FFPE: formalin fixed paraffin embedded FDR: false discovery rate 1

2 BEVEZETŐ Módszerek #3/3 - alkalmazás IHC FISH RT-PCR Microarray RNA-seq Mikrodisszekció Nem Nem Igen Igen Igen Több útvonal vizsgálata Nem Nem Közepes Igen Igen Standardizálás Rossz* Alacsony Közepes** Magas? Automata rendszerek Költség Közepes Közepes Magas Magas Kizárólag Alacsony ( $) Alacsony ( $) Magas (3500$+) Magas (3500$+) Extrém (8,000-30,000$+) TUMOR EREDET *Eredménytelen scoring technikák **RNS izolálás, különböző kontrollgének Ismeretlen eredetű tumor NCCN Carcinomaof UnknownPrimary= váratlan helyen több helyen egyszerre morfológiailag gyengén differenciált NCCN útmutató: fizikai kórtörténet labor képalkotók Ismeretlen eredetű tumor Bloom et al, Am J Pathol, 2004 Útmutatókkal 20-25%-a azonosítható (Hillen, PMJ, 2000) Első multi-tumor osztályozó vizsgálat Összesített előfordulás: daganatok 5%-a Medián túlélés 3-6 hónap Ø megfelelő kezelés / OEP Ø fizet Egyéb technológiák? 2 platform 32k cdna microarray, 78 tumor, 8 tumortípus AffymetrixHU6800 és U95A array, 463 tumor, 21 tumortípus ANN, 85% pontosság 2

3 Toothill et al, Cancer Res, 2005 Fejlesztés: Microarray, próba 229 primer és áttét-minta 14 tumortípus 89%-os pontosság 79 gén, RT-PCR (teszt: 13 beteg) Osztályonkénti top 10 gén HK Ma et al. ArchPatholLabMed, 2006 RT-PCR, 92 gén Fejlesztés: microarray: gén 466fagyasztott (76% primer / 24% áttét) 39 tumotípus, KNN algoritmus 84% pontosság Teszt: 112 FFPE minta (70% primer / 30% áttét) 82% pontosság van Laar et al, Int J Cancer, 2009 Fejlesztés 643 tumor (497 fagyasztott, 146 FFPE) 22k microarray alapján 495 gén (KNN) Print Teszt: 229 tumor (Toothill minták) 94% pontosság Pathwork #1/ probeset/ 15 szöveti típus TOO (Tissueof Origin) vs. 1. Fejlesztés: minta 2. Diszkrimináció validálás: 547 minta (Monzon, JCO, 2009) 3. Reprodukálhatóság validálás: 60 mintán 4 laborban (Dumur, JMD, 2008) Pathwork #2/3 Pathwork #3/3 15 similarity score Skála: könnyen diagnosztizálható IHC rendelkezésre áll 3

4 mirns #1/3 Rosenfeld, Nature, 2008 mirns microarray(600 mirns) 400 FFPE/fagyasztott, 22 tumortípus 48 mirns összesített pontosság: 89% mirns #2/3 DÖNTÉSI FA elágazás mirns 1 Liver hsa-mir-122a,hsa-mir-200cb 2 Testis hsa-mir Nodeno.12 hsa-mir-200c,hsa-mir-181a,hsa-mir Nodeno.5 hsa-mir-146a,hsa-mir-200a,hsa-mir-92a 5 Lymphnode hsa-mir-142-3p,hsa-mir Brain hsa-mir-92b,hsa-mir-9*,hsa-mir-124a 7 Meninges hsa-mir-152,hsa-mir-130a 8 Thymus(B2) hsa-mir-205 Nodeno.11 hsa-mir-192,hsa-mir-21,hsa-mir ,hsa-miR-34b 10Lung-pleura hsa-mir-194,hsa-mir-382,hsa-mir Sarcoma hsa-mir-187,hsa-mir-29b 12Nodeno.13 hsa-mir-145,hsa-mir-194,hsa-mir Nodeno.14 hsa-mir-21,hsa-let-7e 14Colon hsa-let-7i,hsa-mir-29a 15Stomach hsa-mir-214,hsa-mir-19b,hsa-let-7i Nodeno.17 hsa-mir-196a,hsa-mir-363,hsa-mir ,hsa-miR-193a,hsa-miR Breast hsa-mir-27b,hsa-let-7i,hsa-mir-181b Nodeno.19 hsa-mir-205,hsa-mir-141,hsa-mir b,hsa-miR Thyroid hsa-mir-106b,hsa-let-7i,hsa-mir Nodeno.21 hsa-mir-10b,hsa-mir-375,hsa-mir-99a 21Lung hsa-mir-205,hsa-mir-152 Endo- 23Thymus(B3) hsa-mir-192,hsa-mir-345 hsa-mir-345,hsa-mir-29c,hsa-mir metrium Lung hsa-mir-182,hsa-mir-34a,hsa-mir-148b 24(squamous) mirns #3/3 Ismeretlen eredetű tumor összefoglalás 1. elágazás 12. elágazás : tumorok 5%-a nincs kezelés -> rossz prognózis Microarray +/- RT-PCR Pathwork mirns Emlőrák akadémiai vizsgálatok RÁK ÉS MULTIGÉNES MARKEREK 1. Alosztályok 2. Prognózis 3. Terápiás válasz előrejelzése 4

5 Emlőrák termék fejlesztés MammaPrint Prosigna Oncotype DX BLN Assay Theros Breast Cancer Index SM MapQuant DX ARUP Breast Bioclassifier Celera metastatic score exagen BCtm Invasive Gene Signature Wound Response Indicator Mammostrat Tesztek #1/3 - RT-PCR Teszt Assay Cél Név Cég Gének Elérhető száma Szövet Technika Oncotype Dx Genomic Health EU,USA 21 Ffp Q-RT-PCR Prognózis, tamoxifen kezelést követő kiújuláspredikció Theros Breast Cancer Index Biotheranostics USA 2(5) Ffp Q-RT-PCR PM prognózis,endokrin terápiát követő kiújuláspredikció Breast ARUP USA 55 Ffp RT-PCR Prognózis Bioclassifier Celera Metastatic Score Applera - 14 Ffp RT-PCR Prognózis, tamoxifen kezelést követő kiújuláspredikció Tesztek #2/3 - IHC/FISH Teszt Assay Cél Név Cég Gének Elérhető száma Szövet Technika exagen exagen Diagnostics - 3 Ffp FISH Prognózis Mammostrat Applied Genomics USA 5 IHC PM prognózis ProEX TM Br TriPath - 5 IHC Prognózis ProEX TM Br 5 antitestje: E2F TF p21 Ras asszociált fehérje Src kináz SLPI (secretory leukocyte peptidase inhibitor) Proteasome core subunit beta1 Tesztek #3/3 Teszt Assay Cél Név Cég Gének Elérhető száma Szövet Technika MammaPrint Agendia EU,USA 70 F/F Microarray Prognózis 61 éven felül MapQuant Dx Ipsoggen EU 97 F/F Microarray Prognózis Breast Lymph Node (BLN) GeneSearch Veridex UK 76 F/F Microarray Intraoperatív metasztázis kimutatás Assay Invasive Gene F/F Microarray Prognózis Signature Wound Response Indicator F/F Microarray Prognózis Nouvera Biosciences - Microarray Veridex Prognózis, tamoxifen és taxán kezelést követő kiújuláspredikció Oncotype DX #1/8 21 gén RT-PCR Klinikai haszon ER+ betegek adjuváns kemoterápiás kezelésében Távoli áttét (Paik, NEJM, 2004) Túlélés (Habel, BCR, 2006) Kemoterápia hatásossága (Paik, JCO, 2006) ASCO / NCCN útmutatók Magas penetráció Oncotype DX #2/8 ER+ LN- kemoterápia mindenkinek 100-ból 4-nél használ Kinél fog hatni a kemo? Ki valóban alacsony rizikójú? 5

6 Oncotype DX #3/8 250 gén 447 betegből -> 21 gén + recurrencescore(rs) Proliferáció KI-67 STK15 Survivin Cyclin B1 MYBL2 Invázió Stromelysin 3 Cathepsin L2 HER2 GRB7 HER2 BAG1 Ösztrogén ER PGR Bcl2 SCUBE2 GSTM1 CD68 Normalizálás B-aktin GAPDH RPLPO GUS TFRC Oncotype DX #4/8 Klinikai validálás #1 NSABP B-14 vizsgálat (Paik, NEJM, 2004) Csoport Betegek %-a 10 éves recurrence Alacsony (RS<18) 51% 6.8% Nem meghatározható (RS 18-30) 22% 14.3% Magas (RS>30) 27% 30.5% p=0,00001 Oncotype DX #5/8 Klinikai validálás #2 Kemoterápia hatékonyság (Paik, JCO, 2006) RS: alacsony RS: közepes RS: magas KEMO hatása Oncotype DX #6/8 Klinikai döntéshozatal (Oratz, J Oncol Parctice, 2007) Oncotype előtti ajánlás (n=68) Oncotypeután megvalósult kezelés (n=68) Csak hormonterápia 51% 68% Hormonterápia + kemoterápia 49% 32% betegek 25%-ában változott a kezelés Oncotype DX #7/8 Klinikai döntéshozatal: Vizsgálat Hely N Kezelésben változás Referencia Retrospektív USA 32 25% Oratz et al, 2007 Retrospektív USA 85 44% Asad et al, 2008 Retrospektív USA 80 18% Kamal et al, 2007 Prospektív USA 89 32% Lo et al, 2009 Oncotype DX #8/8 HER2 meghatározás (Dabbs és mtsai, JCO november) RT-PCR vs. IHC+FISH ODX(?) ODX(-) ODX (+) Összes IHC/FISH (?) IHC/FISH (-) IHC/FISH (+) Összes Költségek: USD megtakarítás az elmaradó KEMO miatt (DE: USA árak mellett!) ODX nem alkalmas HER2 státusz meghatározására Microsoft Office Word dokumentum 6

7 MammaPrint #1/6 MammaPrint #2/6 Training: van t Veer, Nature, beteg Agilent Hu25k DNS microarray Jó / Rossz prognózis: idő távoli áttétig Áttét <5 év Áttét >5 év Teszt: van de Vijver, NEJM, beteg 70 gén 10 éves túlélés 70 gén: sejtciklus, invázió, áttétképzés, érképzés MammaPrint #3/6 Nyirokcsomó pozitív és negatív betegeknél is: MammaPrint #4/6 Előrejelzés jobb a klinikai és hisztológiai paramétereknél: MammaPrint #5/6 Validálás: Buyse, JNCI, beteg, medián utánkövetés 13,6 év klinikai praméterektől független rizikó-előrejelzés: hatás: 20-30%-al kevesebb KEMO OS MammaPrint #6/6 Klinikai döntéshozatal: - Bueno de Mesquita et al, Lancet, Prospektív vizsgálat, n=427, Hollandia - Klinikai kezelésben változás: 26% (kemo elhagyása) 7

8 Klinikai vizsgálatok TAILORx MINDACT Teszt Oncotype DX Mammaprint Belépés LN- ER+ LN+ betegek Nem Igen Kérdés Ki fog reagálni kemoterápiára? Kinek vanjó prognózisa kemoterápia nélkül? Bevont betegek Randomizált betegek Állapot Lezárva Lezárva Clinical trials NCT NCT Eredmény (várható) 2017 december 2015 március Emlő indikációk Nyirokcsomó negatív Nyirokcsomó nem releváns ER pozitív Oncotype Dx The Theros Breast Cancer Index MapQuant Dx Breast Bioclassifier Celera metastatic score Mammostrat Nouvera Biosciences SEER: ER+ 76,3% nyirokcsomó- 63,5% ER nem releváns Mammaprint Breast Lymph Node BLN Assay exagen Invasive Gene Signature Wound response indicator Emlő összefoglalás ÁTTEKINTÉS OncotypeDX Mammaprint Cég Genomic Health Agendia Alapanyag FFPE F/F (FFPE) Génekszáma 21 (RT-PCR) 70 (microarray) Legfontosabb útvonalak Indikáció Előrejelzés LN- ER+/- LN- ER+ Prognózis Predikció(CMF) Proliferáció, ER, HER-2 LN- ER+/- Prognózis Kor Idősebb betegek Fiatalabb betegek Eredmény Folyamatos Low/Highrisk Költséghatékonyság Igen igen FDA Nem hagyta jóvá Jóváhagyta ASCO Jóváhagyta Vizsgálat alatt PROBLÉMÁK ÁTTEKINTÉS ÁTTEKINTÉS Vizsgálati variabilitás forrásai Mintagyűjtés, mintatárolás Izolálás, jelölés, RNS amplifikálás Platformok különbözősége Statisztikai módszerek Gyenge pontok Alacsony statisztikai erő (20 beteg+) 3000 beteg kellene stabil mintázat felismeréséhez (Ein-Dor, PNAS, 2006) Alacsony mintaszám a fontos gének felismerésének gátja (Ioannidis, Lancet, 2005) Hiányzó / csak házon belüli validáció Más klinikai paraméterek hatásának mellőzése Poszttranszkripciós hatások: mrnsnem feltétlenül utal működő fehérje jelenlétére 8

9 Előrejelzés nehézségei Bioinformatika The motorcarwillneverreplacehorse Motor magazin, 1903 Forcomputers there is a world market formaybefive IBM vezérigazgató, 1943 The internet is justa passingfad - Bill Gates, 1993 GÉNLISTÁK Melanoma #1/2 GÉNLISTÁK Génlisták: közös gének? Gyorffy B, Lage H. A Web-Based Data Warehouse on Gene Expression in Human Malignant Melanoma. J Invest Dermatol Feb;127(2): Gyorffy B, Dietel M, Fekete T, LageH. A snapshotof microarray-generated geneexpression signatures associated with ovarian carcinoma, Int J Gynecol Cancer Nov- Dec;18(6): Referencia Év Technológia Gének # Minták száma Viszonyítva Affymetrix 45 primary melanoma 18 benign skin nevi Talantov et al HGU133A 33 and 7 normal skin Affymetrix human cancer GG-62 cell line 11 non-melanoma cell lines Schaefer et al G Affymetrix 9 melanoma cell lines Normal human Hoek et al HGU133A 590 melanocytes Segal et al Affymetrix HGU95A 30 cell lines and 9 tissue samples 47 STS patient and 1 CCS/MSP cell line Affymetrix 6 cell lines 21 other cell lines Schaefer et al HGU95Av2 92 Atlas human apoptosis and 10 melanoma metastases Normal human melanocytes Nambiar et al cancer array 33 de Wit et al custom oligos 25 IF6 and Mel57 cell lines Nevus nevocellularis Agilent Human patient T-cells 15 healthy control T- Xu et al cdna 9 cells Weeraratna et al SAGE 61 3 melanoma tissues 7 different tissues Melanoma #2/ Leggyakoribb gének HGU133A ID UniGene ID Symbol Gene Title Gene Ontology GÉNLISTÁK _at Hs RAB33A RAB33A, member RAS oncogene family small GTPase mediated signal transduction _s_at Hs ERBB3 v-erb-b2 erythroblastic transmembrane receptor leukemia viral oncogene protein tyrosine kinase homolog 3 (avian) signaling pathway _at Hs.2551 ADRB2 adrenergic, beta-2-, receptor, surface G-protein coupled receptor protein signaling pathway cell growth and/or maintenance _s_at Hs MERTK c-mer proto-oncogene tyrosine kinase _s_at Hs SNF1LK SNF1-like kinase protein amino acid phosphorylation _at Hs ITPKB inositol 1,4,5- signal transduction trisphosphate 3-kinase B Ovárium #1/2 GÉNLISTÁK Publication Year Platform # a Validation (# of Samples investigated genes) Ovarian carcinogenesis Ono et al. (10) 2000 custom, 9121 genes 103 RT-PCR (9) 9 ovarian tumors compared to normal counterparts Mok et al. (54) 2001 Micromax 30 RT-PCR and IHC (1) 3 ovarian tumor cell lines vs 3 normal ovarian surface epithelial cells (validation on 64 patients and 137 control subjects) Welsh et al. (55) 2001 Affymetrix 18 RT-PCR (3) 24 malignant and 4 normal tissues HuGeneFl Tonin et al. (56) 2001 Affymetrix Hs Northern blot (5) 4 spontanously immortalized ovarian cancer cell lines vs 1 normal ovarian surface epithelium Bayani et al. (57) 2002 custom, 1718 genes 26 RT-PCR (3) 17 tumors from 13 patients Zhang et al. (58) 2003 custom, 512 cancer related genes 30 - ovarian carcinomas vs normal ovarian tissues Donninger et al. (59) 2004 Affymetrix HGU133A plus RT-PCR (14) 37 advanced stage papillary serous primary carcinomas Lancaster et al. (60) 2004 Affymetrix HuGeneFL 45 RT-PCR (2) 31 serous ovarian cancer samples compared to 3 normal ovarian epithelial samples Santin et al. (61) 2004 Affymetrix HGU95Av2 114 RT-PCR (2) genes differentiating uterine and ovarian serous papillary carcinomas Zhang et al. (62) 2005 custom, 512 genes 39 IHC (1) ovarian carcinomas vs normal ovarian tissues Le Page et al. (63) 2006 Affymetrix HuGeneFL RT-PCR (13) 65 primary cultures of normal ovarian surface epithelial and epithelial ovarian cancer Bignotti et al. (64) 2006 Affymetrix HGU133A 140 RT-PCR (6) 19 flash-frozen ovarian serous papillary carcinoma vs 15 human ovarian surface epithelium short-term cultures Heinzelmann-Schwarz et al Affymetrix custom: EosHu03 72 RT-PCR (11) 49 primary ovarian cancers and additional normal ovaries (65) Mougeot et al. (66) 2006 Affymetrix HGFA chips ovarian specimens of normal and various cancerous type Histology subtypes Ono et al. (10) 2000 custom, 9121 genes 115 RT-PCR (9) 5 serous adenocarcinomas vs 4 mucinous adenocarcinomas Moreno-Bueno et al. (67) 2003 custom, 6386 genes 66 RT-PCR (6) 24 endometrioid carcinomas compared to 11 nonendometrioid carcinomas Zheng et al. (68) 2004 custom cdna array 9 - serous, borderline and endometrioid ovarian carcinomas Heinzelmann-Schwarz et al Affymetrix custom: EosHu RT-PCR (11) 49 different primary ovarian cancers Therapy response Sugimura et al. (69) 2002 Toyobo arrays 45 RT-PCR (4) the ovarian cancer cell line KF, and its paclitaxel resistant clone treated with paclitaxel Lamendola et al. (70) 2003 Affymetrix HGU95Av paclitaxel resistant sublines compared to parental SKOV-3 line Selvanayagam et al. (71) 2004 custom, genes 16-8 primary ovarian cancer specimens stratified into 2 groups based on their response to cisplatin Macleod et al. (72) 2005 Clontech Atlas human cancer chip 108 RT-PCR (14) cisplatin resistant PE01CDDP compared to parent PE01 cell line 1.2 Samimi et al. (73) 2005 Stanford microarrays oxaliplatin sensitive and stably resistant sublines were compared in 5 cell lines Bild et al. (74) 2006 Affymetrix HGU133A plus recombinant adenovirus-transformed human primary mammary epithelial cell cultures and ovarian and HGU95Av2 cancer samples, beta-catenin and src pathways Cheng et al. (75) 2006 Stanford microarrays 25 RT-PCR (5) 6 pairs of cisplatin resistant and sensitive ovarian carcinoma cells lines Prognosis and progressio Xu et al. (76) 2002 BioDoor 4096 array 22 - high and low metastatic tumor tissues and normal ovarian tissues Adib et al. (77) 2004 Affymetrix HGU95Av2 42 RT-PCR (4) stage III ovarian serous adenocarcinomas vs normal ovarian tissue of the same individuals De Cecco et al. (78) 2004 custom, 4451 cancer-related genes 30 RT-PCR (10) genes differentiating stages III-IV epithelial ovarian cancer samples Lancaster et al. (60) 2004 Affymetrix HuGeneFL 40 RT-PCR (2) 31 serous ovarian cancer samples who either survived less than 2 years or more than 7 years Ouellet et al. (79) 2005 Affymetrix HuGeneFL 45 RT-PCR (8) 37 tumors with low malignant potential and invasive tumors Motamed-Khorasani et al. (80) 2006 custom, genes 17 RT-PCR genes regulated in response to androgen exposure, effect on progression in 149 patients Mougeot et al. (66) 2006 Affymetrix HGFA chips 61 - genes differentiating between early cancer onset and low malignant potential in 27 ovarian cancer samples 9

10 Ovárium #2/2 Ovárium tumorigenezis GÉNLISTÁK Miért kevés az átfedés? GÉNLISTÁK GeneBank Repeat UniGene Name Symbol Gene Ontology Genes identified in more than two studies AB Hs Protein kinase C binding PRKCBP1 DNA binding,cell cycle,regulation of transcription, protein 1 DNA-dependent AI Hs Spondin 1, extracellular SPON1 cell adhesion,development,extracellular matrix (sensu matrix protein Metazoa),protein binding NM_ Hs Tumor-associated calcium TACSTD1 integral to membrane,plasma membrane signal transducer 1 X Hs Protein tyrosine phosphatase, PTPRM hydrolase activity, protein amino acid receptor type, M dephosphorylation,receptor activity, Alacsony mintaszám variabilitás Nem standardizált a mintagyűjtés Terápiás válasz Több microarray platform GenBank Repeat UniGene Name Symbol Gene Ontology BF Hs Interferon induced IFITM1 cell surface receptor linked signal transduction,immune transmembrane protein 1 (9- response,integral to membrane,negative regulation of 27) cell proliferation,plasma membrane,receptor signaling protein activity,regulation of cell cycle,response to biotic stimulus BF Hs Thymosin, beta 4, X-linked TMSB4X NM_ Hs Granulin GRN cell proliferation,cell-cell signaling,cytokine activity,extracellular region,growth factor activity,positive regulation of cell proliferation,signal transduction NM_ Hs Tight junction protein 1 (zona TJP1 intercellular junction assembly,membrane,membrane occludens 1) fraction,protein binding,septate junction,tight junction Sok bioinformatikai módszer KMPLOT Klinikai használhatóság? EGY GÉN VS. Egy gén szerepe KMPLOT Áttekintő Nyers adat n=16k GEO Klinikai adat KMPLOT Minták osztályozása <-> gének osztályozása lekérdezés Minőség-ellenőrzés és MAS5 normalizálás Prognosztikus gének (ABCB1, TOP2A, ER, HER- 2, KI-67 ) További gének: túlélésre gyakorolt hatás független validálása? SEER adatok Génexpresszió filterezése és R input Valós idejű plottolás R-ben Grafikus visszajelzés (KM-görbe) és szignifikancia Platformok kombinálása és második normalizálás mysql adatbázis 10

11 KMPLOT ASCO proliferációs gének és túlélés KMPLOT MARKER GENE NAME AFFYMETRIX ID HR RFS P MKI67 antigen identified by monoclonal antibody _s_at 0.95 ( ) 1 Ki _s_at 1.13 ( ) _s_at 1.8 ( ) 1.14E _s_at 1.3 ( ) CCND1 cyclin D _s_at 1.3 ( ) _at 1.07 ( ) 1* CCND2 cyclin D _s_at 1.2 ( ) _s_at 0.62 ( ) 1.23E _s_at 0.68 ( ) 9.02E-06 CCND3 cyclin D _at 0.7 ( ) CCNE1 cyclin E _at 1.2 ( ) CCNE2 cyclin E _at 2.5 ( ) <1e _s_at 1.2 ( ) 1 CDKN1B cyclin-dependent kinase inhibitor 1B (p27, Kip1) _at 1.3 ( ) CDKN1A cyclin-dependent kinaseinhibitor 1A (p21, _s_at 0.68 ( ) 1.21E-05 Cip1) TK1 thymidine kinase 1, soluble _at 1.2 ( ) TK2 thymidine kinase2, mitochondrial _s_at 0.53 ( ) 7.26E-15* _at 0.67 ( ) 4.18E _s_at 0.81 ( ) TOP2A topoisomerase (DNA) II alpha 170kDa _s_at 2.3 ( ) <1e _at 1.8 ( ) 2.05E-13* TOP2B topoisomerase (DNA) II beta 180kDa _at 1.7 ( ) 4.4E-11 KMPLOT KMPLOT Kaplan-Meier görbék Proliferáció/ kemorezisztencia markerek: TK2 TOP2A Cyclin D1 KM-plot összefoglalás A rendszer lehetővé teszi 22 ezer gén túlélésre gyakorolt hatásának online vizsgálatát emlő/petefészek/nsclc betegekben. Jelölt gének listája: Gyors előrejelzés Minimális bioinformatikai tudás Transzkripció szabályozás Gének és szabályozás Mintagyűjtés, normál / kontroll RNS izolálás DNS-re átírás DNS chipre hibridizálás Bioinformatika (normalizálás, SAM, PAM, clustering) Komplex kiértékelés: pathway analízis REGULÁCIÓS HÁLÓZATOK 11

12 Clustering Hierarchikus génaktivitás K-means Transzkripció áttekintése #1 G É N upstream TSS downstream 5 3 DNS 3 promoter RNS intron exon intron polimeráz mrns Fehérje Hasonlóan regulált gének egy csoportba! idő TSS: transcription start site Transzkripció áttekintése #2 TF TF TSS 5 TFBS TFBS TFBS TFBS 3 DNS 3 RNS intron exon intron polimeráz mrns Fehérje Transzkripciós faktorok #1 Gerincesekben kb db TFBS: cis-regulációs szakaszok (transcription factor binding site) 1 gén több TFBS 1 TF több gén Hossz: 4-10 bázis, nonspecificity, mátrix TF: transcription factor TFBS: transcription factor binding site Transzkripciós faktorok #2 AC T00207 CO Copyright (C), Biobase GmbH. FA E47 SY BCF-1; E2A; E2A-E47; E2A.E47; E47; IEBP1 (rat). OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates SZ 651 AA; 67.3 kda (cdna) SQ MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGG SF basic region contacts DNA, HLH domain is the dimerization[18]; SF binds DNA avidly as homodimer, or as heterodimer [8]; FF part of MEF-1 complex; IN T00003 AS-C T3; fruit fly, Drosophila melanogaster. IN T01629 Atoh2; mouse, Mus musculus. BS R04157 AS$TAL1_01; Quality: 2. BS R02139 E2A$CONS; Quality: 1. AC XX ID XX DT DT CO XX DE XX SQ XX BF SO MM MM Transzkripciós faktor kötőhely R04157 AS$TAL1_ (created); ewi (updated); dbo. Copyright (C), Biobase GmbH. artificial sequence. acctgaacagatggtcggct. T00207 E47; Quality: 2; Species: human, Homo sapiens Jurkat. direct gel shift supershift (antibody binding) 12

13 Transzkripció-regulációs hálózatok Génlista DNS chipek alapján Génlisták microarray adatokból Promoterek azonositása Kötőhelyek azonosítása Felül-reprezentált kötőhelyek Multiple testing korrekció EZ-Retrieveweb-service: 80/EZRetrieve/about.jsp MotifScanner ~thijs/work/motifscanner.html TOUCAN ~saerts/software/toucan.php REGULÁCIÓS HÁLÓZAT FELÁLLITÁSA Példa eredmények Szignifikáns TF-ek TFBS pozíciók META TF n p Bonferroni E Yes EGR No NFY No HEN No ISRE No Meta-analízis TF lista Tímár J, Győrffy B, RásóE. Gene signature of the metastatic potential of cutaneous melanoma: too much for too little? Clin Exp Metastasis Aug;27(6): Melanoma #1/4 Nyers GEO datasetek: melanoma vs. melanoma metasztázis n=3 (zöld) Génlisták MAS5 normalizálás n=11 (sárga) Tükrözés egy Affymetrix platformra (HGU133A) Affymetrix próbákra vetítés Datasetek kombinálása (=minden elérhető adatot tartalmazó adatbázis létrehozása) Ismételten azonosított Génlistákra szűrés VSN normalizálás és adatbázis méretét gének meghatározása csökkentő szűrés (=génlisták (átlag gén < 1% * max minden gén) heterogenitása) PAM alkalmazása a génlisták validálására Unsupervised hierarchical (=génlisták értéke) clustering a primer és áttétes minták összehasonlítására META Melanoma #2/4 META Áttét-mintázatok Year Cohort Platform Bioinformatics # probes / GEO Reference Overall CV Melanoma genes in misclassification metastasis published set error using the misclassification reported genes error primary tumor Custom 17.5k Log2ratio, 42 NA (Wang et al.) 24.2% 5.1% 3 in-transit met cdna unsupervised 28 cutaneous met microarray clustering 35 LND met 2 visceral met primary skin Research Univariate + 4 NA (Becker et al.) NA NA melanoma (mixed Genetics GF200 multivariate histology) arrays analysis 10 met samples of undisclosed origin 2005 situ primary melanoma Affymetrix ANOVA, 105 NA (Smith, Hoek, and 17.2% 13.9% 2 VGP primary melanoma HGU133 Plus 2.0 Benjamini and Becker) 2 metastatic VGP Hochberg, SOM melanoma 2 LND met skin met Clontech Atlas SAM, cluster 33 NA (Nambiar et al.) 20.9% 0.7% human analysis cancer cdna array 1.2K primary skin 20,862 cdna SAM and 2,602 (list not NA (Haqq et al.) - - melanomas of Research hierarchical published) radial+vertical growth Genetics array clustering phase 11 cutaneous mets 7 LND mets primary skin Affymetrix Random 308 NA (Jaeger et al.) 18.1% 0.7% melanoma HGU133A permutation 22 cutaneous mets analysis and support vector machines primary tumor Affymetrix t-test, Pearson 1667 probes GSE7553 (Riker et al.) 5.4% 3.0% 16 cutaneous mets HGU133 Plus 2.0 correlation and (GSE7553 (GSE LND mets SAM excluded) excluded) 2 visceral mets melanoma metastases Affymetrix NA NA GSE8401 NA primary melanomas HGU133A 13

14 META META Melanoma #3/4 Keresztvalidált valószínűségek: Nambiar: (nagy hatékonyság) Smith: (alacsony hatékonyság) Melanoma #4/4 Prognosztikus mintázatok Year Cohort Platform Bioinformatics # probes / genes GEO Reference Overall CV Melanoma in published set datasets misclassificatio metastasis n error using misclassificati the reported on error genes visceral met Custom Log ratio, 22 NA (Bittner et al.) 22.8% 5.1% 1 LND met 8,150 oligo hierarchical 27 cell lines array cluster cutaneous 17,500 SAM, SPC 80 probes (70 NA (Mandruzzato et 29.3% 18.9% mets element genes) al.) 30 LND mets cdna 2 visceral mets microarray primary Pangenomic Cox 254 probes NA (Winnepenninck 19.5% 4.3% melanoma 44k oligo multivariable x et al.) 29 validation microarray model and set primary stratified logrank test melanoma melanomas Affymetrix ANOVA and 296 probes GSE4845 (Hoek et al.) 27.6% 11.9% in 3 cohorts HGU133A clustering (GSE4845 (GSE4845 with different /Plus 2.0 excluded) excluded) metastatic potential LND mets 30,888 ANOVA, hclust, 21 NA (John et al.) 26.1% 11.7% 10 LND mets MWG PCA (validation) oligonucleo tide array Post-processing Zárszó: klinikai vizsgálatok?! 1. Génlisták Átfedő gének listája Jelátviteli útvonalak (gene ontology) Biomarkerek(egy gén szerepe) Transzkripció szabályozása 2. Meta-analízis Génlista validálása Nagyobb adatbázison valódi meta 14

OncotypeDX Korai emlőrák és a genetika biztosan mindent tudunk betegünkről a helyes terápia megválasztásához? Boér Katalin

OncotypeDX Korai emlőrák és a genetika biztosan mindent tudunk betegünkről a helyes terápia megválasztásához? Boér Katalin OncotypeDX Korai emlőrák és a genetika biztosan mindent tudunk betegünkről a helyes terápia megválasztásához? Boér Katalin Korai HR+, HER2- emlőrák kezelése ormonterápia emoterápia - előnye 4,4% lasszikus

Részletesebben

OncotypeDX és más genetikai tesztek emlőrákban és azon túl. Dr. Nagy Zoltán Med Gen-Sol Kft.

OncotypeDX és más genetikai tesztek emlőrákban és azon túl. Dr. Nagy Zoltán Med Gen-Sol Kft. OncotypeDX és más genetikai tesztek emlőrákban és azon túl Dr. Nagy Zoltán Med Gen-Sol Kft. 2 A betegek leggyakoribb kérdései! Kiújul a betegségem?! Kell kemoterápiát kapnom?! A beteg és környezete életét,

Részletesebben

dr. Udvarhelyi NóraN Frank Diagnosztika-Dako ziuma 2008.12.05.

dr. Udvarhelyi NóraN Frank Diagnosztika-Dako ziuma 2008.12.05. MOLEKULÁRIS PATHOLÓGIAI CÉLPONTOK AZ EMLŐRÁKBAN dr. Udvarhelyi NóraN Frank Diagnosztika-Dako Dako Szimpóziuma ziuma 2008.12.05. Az emlőrák k genotípusa, fenotípusa és klinikai lefolyása is igen heterológ.

Részletesebben

Epithelialis-mesenchymalis átmenet vastagbél daganatokban

Epithelialis-mesenchymalis átmenet vastagbél daganatokban Epithelialis-mesenchymalis átmenet vastagbél daganatokban Éles Klára Országos Onkológiai Intézet Sebészi és Molekuláris Daganatpatológiai Centrum Budapest, 2010. 12. 03. Epithelialis-mesenchymalis átmenet

Részletesebben

Válasz Dr. Balázs Margit, az MTA doktora bírálatára

Válasz Dr. Balázs Margit, az MTA doktora bírálatára Válasz Dr. Balázs Margit, az MTA doktora bírálatára Mindenek előtt tisztelettel köszönöm Balázs Margit Professzor Asszonynak, hogy elvállalta doktori munkám opponensi feladatát, valamint az elért eredményeinkre

Részletesebben

"A genius is one per cent inspiration and ninety nine per cent perspiration." Thomas A. Edison

A genius is one per cent inspiration and ninety nine per cent perspiration. Thomas A. Edison "A genius is one per cent inspiration and ninety nine per cent perspiration." Thomas A. Edison Zorn-Keszthelyi Rita laborvezető Hisztopatológia Kft, Pécs www.histopat.hu Pécs, 2013. június 7. Alapítás

Részletesebben

Dr Csőszi Tibor Hetenyi G. Kórház, Onkológiai Központ

Dr Csőszi Tibor Hetenyi G. Kórház, Onkológiai Központ Dr Csőszi Tibor Hetenyi G. Kórház, Onkológiai Központ Azért, mert a kemoterápia bizonyított módon fokozza a gyógyulás esélyét! A kemoterápiának az a célja, hogy az esetleg, vagy biztosan visszamaradt daganatsejtek

Részletesebben

Szövettan kérdései Ami a terápiát meghatározza és ami segíti Dr. Sápi Zoltán

Szövettan kérdései Ami a terápiát meghatározza és ami segíti Dr. Sápi Zoltán Szövettan kérdései Ami a terápiát meghatározza és ami segíti Dr. Sápi Zoltán 1.Számú Patológiai és Kísérleti Rákkutató Intézet Diagnózis (definitív): benignus, malignus, intermedier malignitás, borderline

Részletesebben

Tumorprogresszió és előrejelzése. Statisztikák. Statisztika - USA Megbetegedés / 10 leggyakoribb (2012)

Tumorprogresszió és előrejelzése. Statisztikák. Statisztika - USA Megbetegedés / 10 leggyakoribb (2012) Tumorprogresszió és előrejelzése 1. Statisztikák 2. Kezelési protokollok 3. Jövő 4. Teszt írása Megbetegedés / 1 leggyakoribb (212) Statisztikák Forrás: CA Halálozás / 1 leggyakoribb (212) Statisztika

Részletesebben

Géneltérések biológiai szerepe és prognosztikai jelentősége humán malignus melanomákban

Géneltérések biológiai szerepe és prognosztikai jelentősége humán malignus melanomákban 268 Doktori tézisek Géneltérések biológiai szerepe és prognosztikai jelentősége humán malignus melanomákban Vízkeleti Laura Debreceni Egyetem, Egészségtudományok Doktori Iskola, Debrecen Témavezető: Prof.

Részletesebben

Her2 fehérje overexpresszió gyomorrákokban: Hazai tapasztalatok

Her2 fehérje overexpresszió gyomorrákokban: Hazai tapasztalatok Her2 fehérje overexpresszió gyomorrákokban: Hazai tapasztalatok Dr. Lotz Gábor, Dr. Szirtes Ildikó, Dr. Kiss András Prof. Tímár József, Prof. Kulka Janina Semmelweis Egyetem II. Pathologiai Intézet - Exophyticus

Részletesebben

Genomiális eltérések és génexpressszió közötti kapcsolat vizsgálata, melanomák metasztázisképzésére jellemző genetikai markerek kutatása

Genomiális eltérések és génexpressszió közötti kapcsolat vizsgálata, melanomák metasztázisképzésére jellemző genetikai markerek kutatása A 48750 OTKA pályázat eredményeit összefoglaló szakmai záróbeszámoló A pályázat címe Genomiális eltérések és génexpressszió közötti kapcsolat vizsgálata, melanomák metasztázisképzésére jellemző genetikai

Részletesebben

GÉNEXPRESSZIÓ MÉRÉSÉN ALAPULÓ MULTIGÉNES PROGNOSZTIKAI ÉS PREDIKTÍV ELŐREJELZÉS EMLŐTUMOROKBAN

GÉNEXPRESSZIÓ MÉRÉSÉN ALAPULÓ MULTIGÉNES PROGNOSZTIKAI ÉS PREDIKTÍV ELŐREJELZÉS EMLŐTUMOROKBAN GÉNEXPRESSZIÓ MÉRÉSÉN ALAPULÓ MULTIGÉNES PROGNOSZTIKAI ÉS PREDIKTÍV ELŐREJELZÉS EMLŐTUMOROKBAN Pénzváltó Zsófia, Mihály Zsuzsa, Győrffy Balázs Magyar Tudományos Akadémia és Semmelweis Egyetem Gyermekgyógyászati

Részletesebben

A zoledronsav klinikai és preklinikai. Dr. Nagykálnai Tamás Magyar Szenológiai Társaság Kongresszusa Balatonfüred 2009. október 9.-10.

A zoledronsav klinikai és preklinikai. Dr. Nagykálnai Tamás Magyar Szenológiai Társaság Kongresszusa Balatonfüred 2009. október 9.-10. A zoledronsav klinikai és preklinikai evidenciái az emlőrák kezelésében Dr. Nagykálnai Tamás Magyar Szenológiai Társaság Kongresszusa Balatonfüred 2009. október 9.-10. Kísérleti modellekben antitumoros

Részletesebben

Norvég Finanszírozási Mechanizmus által támogatott projekt HU-0115/NA/2008-3/ÖP-9 ÚJ TERÁPIÁS CÉLPONTOK AZONOSÍTÁSA GENOMIKAI MÓDSZEREKKEL

Norvég Finanszírozási Mechanizmus által támogatott projekt HU-0115/NA/2008-3/ÖP-9 ÚJ TERÁPIÁS CÉLPONTOK AZONOSÍTÁSA GENOMIKAI MÓDSZEREKKEL Norvég Finanszírozási Mechanizmus által támogatott projekt HU-0115/NA/2008-3/ÖP-9 ÚJ TERÁPIÁS CÉLPONTOK AZONOSÍTÁSA GENOMIKAI MÓDSZEREKKEL KÖZÖS STRATÉGIA KIFEJLESZTÉSE MOLEKULÁRIS MÓDSZEREK ALKALMAZÁSÁVAL

Részletesebben

Chapter 10 Hungarian Summary. Az onkológiai gyógyszerfejlesztés eredetileg DNS-károsodást indukáló vegyületekre

Chapter 10 Hungarian Summary. Az onkológiai gyógyszerfejlesztés eredetileg DNS-károsodást indukáló vegyületekre 10 Összefoglaló Összefoglaló Az onkológiai gyógyszerfejlesztés eredetileg DNS-károsodást indukáló vegyületekre összpontosított, melyek az osztódó rákos sejteket célozzák meg. Jelenleg, nagy hangsúly fektetődik

Részletesebben

II./3.3.2 fejezet:. A daganatok célzott kezelése

II./3.3.2 fejezet:. A daganatok célzott kezelése II./3.3.2 fejezet:. A daganatok célzott kezelése Kopper László A fejezet célja, hogy megismerje a hallgató a célzott terápiák lehetőségeit és a fejlesztés lényeges lépéseit. A fejezet teljesítését követően

Részletesebben

Fulvesztrant szerepe az előrehaladott emlőrák kezelésében St. Gallen 2013 Dr. Maráz Róbert

Fulvesztrant szerepe az előrehaladott emlőrák kezelésében St. Gallen 2013 Dr. Maráz Róbert Fulvesztrant szerepe az előrehaladott emlőrák kezelésében St. Gallen 2013 Dr. Maráz Róbert Kecskemét Május 18. Az előadás az AstraZeneca Kft. felkérésére készült Engedélyszám: PEFA0134HU20130516 Kiknél

Részletesebben

Emlődaganatok gyógyszeres kezelés. Dr.Tóth Judit DE OEC Onkológiai Tanszék

Emlődaganatok gyógyszeres kezelés. Dr.Tóth Judit DE OEC Onkológiai Tanszék Emlődaganatok gyógyszeres kezelés Dr.Tóth Judit DE OEC Onkológiai Tanszék Epidemiológia Kb.7000-8000 új eset évente Mo-on Idősebbek betegsége: -25 éves korban: 5/100 000-50 éves korban: 150/100 000-75

Részletesebben

AZ ÁRPA SZÁRAZSÁGTŰRÉSÉNEK VIZSGÁLATA: QTL- ÉS ASSZOCIÁCIÓS ANALÍZIS, MARKER ALAPÚ SZELEKCIÓ, TILLING

AZ ÁRPA SZÁRAZSÁGTŰRÉSÉNEK VIZSGÁLATA: QTL- ÉS ASSZOCIÁCIÓS ANALÍZIS, MARKER ALAPÚ SZELEKCIÓ, TILLING Hagyomány és haladás a növénynemesítésben AZ ÁRPA SZÁRAZSÁGTŰRÉSÉNEK VIZSGÁLATA: QTL- ÉS ASSZOCIÁCIÓS ANALÍZIS, MARKER ALAPÚ SZELEKCIÓ, BÁLINT ANDRÁS FERENC 1, SZIRA FRUZSINA 1, ANDREAS BÖRNER 2, KERSTIN

Részletesebben

A hólyagrák aktuális kérdései a pathologus szemszögéből. Iványi Béla SZTE Pathologia

A hólyagrák aktuális kérdései a pathologus szemszögéből. Iványi Béla SZTE Pathologia A hólyagrák aktuális kérdései a pathologus szemszögéből Iványi Béla SZTE Pathologia Hólyagrák 7. leggyakoribb carcinoma Férfi : nő arány 3.5 : 1 Csúcsa: 60-80 év között Oka: jórészt ismeretlen Rizikótényezők:

Részletesebben

pt1 colorectalis adenocarcinoma: diagnózis, az invázió fokának meghatározása, a daganatos betegség ellátása (EU guideline alapján)

pt1 colorectalis adenocarcinoma: diagnózis, az invázió fokának meghatározása, a daganatos betegség ellátása (EU guideline alapján) pt1 colorectalis adenocarcinoma: diagnózis, az invázió fokának meghatározása, a daganatos betegség ellátása (EU guideline alapján) Szentirmay Zoltán Országos Onkológiai Intézet Daganatpatológiai Centrum

Részletesebben

A hem-oxigenáz/vegf rendszer indukciója nőgyógyászati tumorokban. Óvári László

A hem-oxigenáz/vegf rendszer indukciója nőgyógyászati tumorokban. Óvári László A hem-oxigenáz/vegf rendszer indukciója nőgyógyászati tumorokban Óvári László HO-1, CO,VEGF biokémia rendszer Gyulladások Sebgyógyulás Placentáció HO-1, VEGF-onkológia-irodalom HO-1 nagy mértékében expresszálódik

Részletesebben

Transzkriptom szintű adatok alkalmazása a rosszindulatú daganatos betegek várható terápiás válaszának és túlélésének előrejelzésére

Transzkriptom szintű adatok alkalmazása a rosszindulatú daganatos betegek várható terápiás válaszának és túlélésének előrejelzésére MTA DOKTORI PÁLYÁZAT Akadémiai Doktori Értekezés Transzkriptom szintű adatok alkalmazása a rosszindulatú daganatos betegek várható terápiás válaszának és túlélésének előrejelzésére Dr. Győrffy Balázs,

Részletesebben

Orvosi Genomtudomány 2014 Medical Genomics 2014. Április 8 Május 22 8th April 22nd May

Orvosi Genomtudomány 2014 Medical Genomics 2014. Április 8 Május 22 8th April 22nd May Orvosi Genomtudomány 2014 Medical Genomics 2014 Április 8 Május 22 8th April 22nd May Hét / 1st week (9. kalendariumi het) Takács László / Fehér Zsigmond Magyar kurzus Datum/ido Ápr. 8 Apr. 9 10:00 10:45

Részletesebben

SUPRACLAVICULARIS NYIROKCSOMÓ DAGANATOK DIFFERENCIÁLDIAGNOSZTIKÁJA CSAPDÁK

SUPRACLAVICULARIS NYIROKCSOMÓ DAGANATOK DIFFERENCIÁLDIAGNOSZTIKÁJA CSAPDÁK SUPRACLAVICULARIS NYIROKCSOMÓ DAGANATOK DIFFERENCIÁLDIAGNOSZTIKÁJA CSAPDÁK Péter Ilona¹, Boér András² és Orosz Zsolt¹ Országos Onkológiai Intézet, Humán és Kísérletes Daganatpatológiai Osztály¹ és Fej-Nyak,

Részletesebben

Digitalizált immunhisztokémiai reakciók automatikus kiértékelése a Pannoramic TM Platform-mal

Digitalizált immunhisztokémiai reakciók automatikus kiértékelése a Pannoramic TM Platform-mal Digitalizált immunhisztokémiai reakciók automatikus kiértékelése a Pannoramic TM Platform-mal Micsik Tamás, Kiszler Gábor, Szabó Dániel, Krecsák László, Krenács Tibor, Molnár Béla I számú Patológiai és

Részletesebben

A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon

A rosszindulatú daganatos halálozás változása 1975 és 2001 között Magyarországon A rosszindulatú daganatos halálozás változása és között Eredeti közlemény Gaudi István 1,2, Kásler Miklós 2 1 MTA Számítástechnikai és Automatizálási Kutató Intézete, Budapest 2 Országos Onkológiai Intézet,

Részletesebben

Modern terápiás szemlélet az onkológiában

Modern terápiás szemlélet az onkológiában Modern terápiás szemlélet az onkológiában Dr. Horváth Anna Semmelweis Egyetem, III.Belgyógyászati Klinika Haemato-Onkológiai osztály Budapest, 1125. Kútvölgyi út 4. TERÁPIÁS SZEMLÉLET VÁLTOZÁSA AZ ONKOLÓGIÁBAN?

Részletesebben

Sebész szerepe az axilla ellátásában Mersich Tamás Uzsoki utcai Kórház Sebészeti-onkosebészeti Osztály 2014. május 24. Kecskemét Bevezetés A nyirokcsomók sebészi eltávolítása felel a legtöbb szövődményért

Részletesebben

Válasz prof.dr. Kopper László bírálatára

Válasz prof.dr. Kopper László bírálatára Válasz prof.dr. Kopper László bírálatára Tisztelettel köszönöm Kopper László Professzor Úrnak az igen alapos, részletekbe menő bírálatát és a nyilvános vitára bocsátást támogató nyilatkozatot. Válaszok

Részletesebben

Tüdő adenocarcinomásbetegek agyi áttéteiben jelenlévő immunsejtek, valamint a PD-L1 és PD-1 fehérjék túlélésre gyakorolt hatása

Tüdő adenocarcinomásbetegek agyi áttéteiben jelenlévő immunsejtek, valamint a PD-L1 és PD-1 fehérjék túlélésre gyakorolt hatása Tüdő adenocarcinomásbetegek agyi áttéteiben jelenlévő immunsejtek, valamint a és PD-1 fehérjék túlélésre gyakorolt hatása Téglási Vanda, MoldvayJudit, Fábián Katalin, Csala Irén, PipekOrsolya, Bagó Attila,

Részletesebben

A csontvelői eredetű haem-és lymphangiogén endothel progenitor sejtek szerepe tüdőrákokban. Doktori tézisek. Dr. Bogos Krisztina

A csontvelői eredetű haem-és lymphangiogén endothel progenitor sejtek szerepe tüdőrákokban. Doktori tézisek. Dr. Bogos Krisztina A csontvelői eredetű haem-és lymphangiogén endothel progenitor sejtek szerepe tüdőrákokban Doktori tézisek Dr. Bogos Krisztina Semmelweis Egyetem Klinikai Orvostudományok Doktori Iskola Pulmonológia program

Részletesebben

ZÁRÓJELENTÉS 2004-2007 A MOLEKULÁRIS ONKOGENEZIS MECHANIZMUSAI GYAKORI DAGANATOKBAN C. PÁLYÁZAT TELJESÍTÉSÉRŐL

ZÁRÓJELENTÉS 2004-2007 A MOLEKULÁRIS ONKOGENEZIS MECHANIZMUSAI GYAKORI DAGANATOKBAN C. PÁLYÁZAT TELJESÍTÉSÉRŐL ZÁRÓJELENTÉS 2004-2007 A MOLEKULÁRIS ONKOGENEZIS MECHANIZMUSAI GYAKORI DAGANATOKBAN C. PÁLYÁZAT TELJESÍTÉSÉRŐL EREDMÉNYEK Munkacsoportunk úttörő szerepet játszott a molekuláris onkológiai (onkogenetikai)

Részletesebben

DIGITÁLIS MIKROSZKÓPIA AZ EMÉSZTŐRENDSZERI SZÖVETI

DIGITÁLIS MIKROSZKÓPIA AZ EMÉSZTŐRENDSZERI SZÖVETI DIGITÁLIS MIKROSZKÓPIA AZ EMÉSZTŐRENDSZERI SZÖVETI MINTÁK DIAGNOSZTIKÁJÁBAN Doktori tézisek Ficsór Levente Semmelweis Egyetem, 2. sz. Belgyógyászati Klinika Klinikai Orvostudományok Doktori Iskola Programvezető:

Részletesebben

2016 év eleji ajánlatok. Speciális áraink 2016 május 31-ig érvényesek!

2016 év eleji ajánlatok. Speciális áraink 2016 május 31-ig érvényesek! 2016 év eleji ajánlatok Speciális áraink 2016 május 31-ig érvényesek! BIOBASE műszerek a NucleotestBio Kft. kínálatában! Steril box-ok, lamináris box-ok: Hűtők, fagyasztók, ultramélyhűtők, autoklávok,

Részletesebben

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Dr. Czeglédi Levente Dr. Béri Béla Kutatás-fejlesztés támogatása a megújuló energiaforrások és agrár

Részletesebben

A patológia modern eszközei a diagnosztikában és a terápiában

A patológia modern eszközei a diagnosztikában és a terápiában A patológia modern eszközei a diagnosztikában és a terápiában Kulka Janina Ünnepi tudományos ülés a 20 éves tiszteletére Képek: Vákuum, LIS, Immunfestő automata Scanner Digitális metszet kiértékelés Molekuláris

Részletesebben

Kvantitatív immunhisztokémia a patológiában

Kvantitatív immunhisztokémia a patológiában Kvantitatív immunhisztokémia a patológiában Krenács Tibor Semmelweis Egyetem I.sz. Patológiai és Kísérleti Rákkutató Intézet, Budapest MPT Kongresszus Siófok, 2013. szeptember 26-28. Kvantitatív Patológia

Részletesebben

A HER2-negatív emlőrák kezelési stratégiái

A HER2-negatív emlőrák kezelési stratégiái A HER2-negatív emlőrák kezelési stratégiái Dr. Landherr László Uzsoki Utcai Kórház Magyar Szenológiai Társaság Tudományos Fóruma - 2012 Klinikai igények Az eredetileg rosszabb prognózisú HER2-pozitív emlőrák

Részletesebben

A tüdőrák agyi metasztázisainak komplex kezelése az onkopulmonológus szemszögéből

A tüdőrák agyi metasztázisainak komplex kezelése az onkopulmonológus szemszögéből A tüdőrák agyi metasztázisainak komplex kezelése az onkopulmonológus szemszögéből Ostoros Gyula Országos Korányi TBC és Pulmonológiai Intézet 2007. október 6. Az onkológia jelenlegi legnagyobb kihívása

Részletesebben

A tüdőcitológia jelentősége a tüdődaganatok neoadjuváns kezelésének tervezésében

A tüdőcitológia jelentősége a tüdődaganatok neoadjuváns kezelésének tervezésében A tüdőcitológia jelentősége a tüdődaganatok neoadjuváns kezelésének tervezésében Pápay Judit SE, I.sz.Patológiai és Kísérleti Rákkutató Intézet 70. Patológus Kongresszus Siófok 2011. szept. 29 - okt.1.

Részletesebben

Jelátviteli uatk és daganatképződés

Jelátviteli uatk és daganatképződés Jelátviteli uatk és daganatképződés Tímár József Semmelweis Egyetem, Klinikai Központ 2.sz. Patológiai Intézet MTA-SE Molekuláris Onkológia Kutatócsoport, Budapest A HER-2 genetikája emberi daganatokban

Részletesebben

http://www.rimm.dote.hu Tumor immunológia

http://www.rimm.dote.hu Tumor immunológia http://www.rimm.dote.hu Tumor immunológia A tumorok és az immunrendszer kapcsolatai Tumorspecifikus és tumorasszociált antigének A tumor sejteket ölő sejtek és mechanizmusok Az immunológiai felügyelet

Részletesebben

mintasepcifikus mikrokapilláris elektroforézis Lab-on-Chip elektroforézis / elektrokinetikus elven DNS, RNS, mirns 12, fehérje 10, sejtes minta 6

mintasepcifikus mikrokapilláris elektroforézis Lab-on-Chip elektroforézis / elektrokinetikus elven DNS, RNS, mirns 12, fehérje 10, sejtes minta 6 Agilent 2100 Bioanalyzer mikrokapilláris gélelektroforézis rendszer G2943CA 2100 Bioanalyzer system forgalmazó: Kromat Kft. 1112 Budapest Péterhegyi u. 98. t:36 (1) 248-2110 www.kromat.hu bio@kromat.hu

Részletesebben

Új temékek az UD-GenoMed Kft. kínálatában!

Új temékek az UD-GenoMed Kft. kínálatában! Új temékek az UD-GenMed Kft. kínálatában! Műanyag termékek: SARSTEDT műanyag termékek teljes választéka Egyszer használats labratóriumi műanyag eszközök szövet és sejttenyésztéshez Vérvételi és diagnsztikai

Részletesebben

The nontrivial extraction of implicit, previously unknown, and potentially useful information from data.

The nontrivial extraction of implicit, previously unknown, and potentially useful information from data. Budapesti Műszaki és Gazdaságtudományi Egyetem Méréstechnika és Információs rendszerek Tanszék Adatelemzés intelligens módszerekkel Hullám Gábor Adatelemzés hagyományos megközelítésben I. Megválaszolandó

Részletesebben

67. Pathologus Kongresszus

67. Pathologus Kongresszus A kemoirradiáció okozta oncocytás átalakulás szövettani, immunhisztokémiai, ultrastruktúrális jellemzői és lehetséges prognosztikus jelentősége rectum adenocarcinomákban 67. Pathologus Kongresszus Bogner

Részletesebben

Metasztatikus HER2+ emlőrák kezelése: pertuzumab-trasztuzumab és docetaxel kombinációval szerzett tapasztalataink esetismertetés kapcsán

Metasztatikus HER2+ emlőrák kezelése: pertuzumab-trasztuzumab és docetaxel kombinációval szerzett tapasztalataink esetismertetés kapcsán Metasztatikus HER2+ emlőrák kezelése: pertuzumab-trasztuzumab és docetaxel kombinációval szerzett tapasztalataink esetismertetés kapcsán Dr. Gelencsér Viktória, Dr. Boér Katalin Szent Margit Kórház, Onkológiai

Részletesebben

20 éves a Mamma Klinika

20 éves a Mamma Klinika 20 éves a Mamma Klinika A sejtdiagnosztika modern eszközei a diagnosztikában és terápiában dr Járay Balázs, dr Székely Eszter Medserv Kft, Semmelweis Egyetem II. Patológiai Intézet Budapest 1 22196 betegből

Részletesebben

A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei

A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A TM vizsgálatok alapkérdései A vizsgálatok célja, információértéke? Az alkalmazás területei? Hogyan válasszuk ki az alkalmazott

Részletesebben

10. Genomika 2. Microarrayek és típusaik

10. Genomika 2. Microarrayek és típusaik 10. Genomika 2. 1. Microarray technikák és bioinformatikai vonatkozásaik Microarrayek és típusaik Korrelált génexpresszió mint a funkcionális genomika eszköze 2. Kombinált megközelítés a funkcionális genomikában

Részletesebben

Report on the main results of the surveillance under article 11 for annex II, IV and V species (Annex B)

Report on the main results of the surveillance under article 11 for annex II, IV and V species (Annex B) 0.1 Member State HU 0.2.1 Species code 1358 0.2.2 Species name Mustela putorius 0.2.3 Alternative species scientific name 0.2.4 Common name házigörény 1. National Level 1.1 Maps 1.1.1 Distribution Map

Részletesebben

A PET szerepe a gyógyszerfejlesztésben. Berecz Roland DE KK Pszichiátriai Tanszék

A PET szerepe a gyógyszerfejlesztésben. Berecz Roland DE KK Pszichiátriai Tanszék A PET szerepe a gyógyszerfejlesztésben Berecz Roland DE KK Pszichiátriai Tanszék Gyógyszerfejlesztés Felfedezés gyógyszertár : 10-15 év Kb. 1 millárd USD/gyógyszer (beleszámolva a sikertelen fejlesztéseket)

Részletesebben

sikeresnek bizonyult, és ami a legfontosabb az onkoterápiában, hogy a vegyület nem toxikus, ezért igen magas dózissal is eredményesn alkalmazható.

sikeresnek bizonyult, és ami a legfontosabb az onkoterápiában, hogy a vegyület nem toxikus, ezért igen magas dózissal is eredményesn alkalmazható. Turmeric Live Extract 30db A teljes kurkuma kivonat hatásának rövid jellemzése A Turmeric Live Extract bonyolult, számos eltérő molekulát tartalmazó összetett hatóanyag. A turmeron/ol különböző formáit,

Részletesebben

eljárásokkal Doktori tézisek Szatmári Tünde Semmelweis Egyetem Klinikai Orvostudományok Doktori Iskola Sugárterápia Program

eljárásokkal Doktori tézisek Szatmári Tünde Semmelweis Egyetem Klinikai Orvostudományok Doktori Iskola Sugárterápia Program Agydaganatok sugárterápia iránti érzékenységének növelése génterápiás eljárásokkal Doktori tézisek Szatmári Tünde Semmelweis Egyetem Klinikai Orvostudományok Doktori Iskola Sugárterápia Program Doktori

Részletesebben

SZTE-ELTE PROTEOMIKAI INNOVÁCIÓ: KONCEPCIÓ, EREDMÉNYEK, JÖVŐKÉP

SZTE-ELTE PROTEOMIKAI INNOVÁCIÓ: KONCEPCIÓ, EREDMÉNYEK, JÖVŐKÉP SZTE-ELTE PROTEOMIKAI INNOVÁCIÓ: KONCEPCIÓ, EREDMÉNYEK, JÖVŐKÉP Minden elméletet úgy is meg lehet alkotni, hogy az általa sugallt kísérletek csak magát az elméletet erősítsék meg Konrad Lorenz A SEJTMŰKÖDÉS

Részletesebben

Lymphoma sejtvonalak és gyerekkori leukémia (ALL) sejtek mikro RNS (mir) profiljának vizsgálata

Lymphoma sejtvonalak és gyerekkori leukémia (ALL) sejtek mikro RNS (mir) profiljának vizsgálata Lymphoma sejtvonalak és gyerekkori leukémia (ALL) sejtek mikro RNS (mir) profiljának vizsgálata Dr. Nemes Karolina, Márk Ágnes, Dr. Hajdu Melinda, Csorba Gézáné, Dr. Kopper László, Dr. Csóka Monika, Dr.

Részletesebben

XIII./5. fejezet: Terápia

XIII./5. fejezet: Terápia XIII./5. fejezet: Terápia A betegek kezelésekor a sebészi kezelés, a kemoterápia (klasszikus citotoxikus és a biológiai terápia), a radioterápia és ezek együttes alkalmazása egyaránt szóba jön. A gégének

Részletesebben

Transzkriptom szintű adatok alkalmazása a rosszindulatú daganatos betegek várható terápiás válaszának és túlélésének előrejelzésére

Transzkriptom szintű adatok alkalmazása a rosszindulatú daganatos betegek várható terápiás válaszának és túlélésének előrejelzésére MTA Doktori Pályázat TÉZISEK Transzkriptom szintű adatok alkalmazása a rosszindulatú daganatos betegek várható terápiás válaszának és túlélésének előrejelzésére Dr. Győrffy Balázs, PhD Budapest, 2013 1

Részletesebben

A sejt és szövettani diagnosztika modern eszközei a diagnosztikában és terápiában. Cifra János. Tolna Megyei Balassa János Kórház, Pathologia Osztály

A sejt és szövettani diagnosztika modern eszközei a diagnosztikában és terápiában. Cifra János. Tolna Megyei Balassa János Kórház, Pathologia Osztály A sejt és szövettani diagnosztika modern eszközei a diagnosztikában és terápiában Cifra János Tolna Megyei Balassa János Kórház, Pathologia Osztály Szekszárd 2016. Május 6. Patológus feladatai Preoperatív

Részletesebben

Az Oxidatív stressz hatása a PIBF receptor alegységek összeszerelődésére.

Az Oxidatív stressz hatása a PIBF receptor alegységek összeszerelődésére. Újabban világossá vált, hogy a Progesterone-induced blocking factor (PIBF) amely a progesteron számos immunológiai hatását közvetíti, nem csupán a lymphocytákban és terhességgel asszociált szövetekben,

Részletesebben

Claudinok szerepe az emlőrák prognózisának meghatározásában. Dr. Szász A. Marcell

Claudinok szerepe az emlőrák prognózisának meghatározásában. Dr. Szász A. Marcell Claudinok szerepe az emlőrák prognózisának meghatározásában Doktori tézisek Dr. Szász A. Marcell Semmelweis Egyetem Patológiai Doktori Iskola Témavezető: Dr. Kulka Janina, egyetemi tanár, Ph.D. Hivatalos

Részletesebben

Diagnosztikai célú molekuláris biológiai vizsgálatok

Diagnosztikai célú molekuláris biológiai vizsgálatok Diagnosztikai célú molekuláris biológiai vizsgálatok Dr. Patócs Attila, PhD MTA-SE Molekuláris Medicina Kutatócsoport, Semmelweis Egyetem II. sz. Belgyógyászati Klinika Laboratóriumi Medicina Intézet Genetikai

Részletesebben

Emlődaganatok célzott kezelése

Emlődaganatok célzott kezelése Emlődaganatok célzott kezelése Dr. Tőkés Tímea Semmelweis Egyetem Onkológiai Központ Sorlie et al. PNAS u September 11, 2001 u vol. 98 u no. 19 u 10869 10874 Az emlőrák heterogén betegség biológiai és

Részletesebben

és biztonságoss Prof. Dr. János J CHMP member Hungary

és biztonságoss Prof. Dr. János J CHMP member Hungary Gyógyszerek hatásoss sossága és biztonságoss gosságaga Prof. Dr. János J Borvendég CHMP member Hungary A ma gyógyszerkutat gyszerkutatásának legfontosabb célbetegségei: gei: malignus betegségek gek cardiovascularis

Részletesebben

Prediktív markers and the immunotherapy of cancer

Prediktív markers and the immunotherapy of cancer Prediktív markers and the immunotherapy of cancer József Tímár 2nd Department of Pathology Semmelweis University Budapest Molecular Oncology Research Group Hungarian Academy of Sciences Figure?3 Emerging

Részletesebben

A vastagbélhám sejtkinetikai változásainak vizsgálata gyulladásos vastagbélbetegségekben a gyulladás szövettani aktivitásának függvényében

A vastagbélhám sejtkinetikai változásainak vizsgálata gyulladásos vastagbélbetegségekben a gyulladás szövettani aktivitásának függvényében A vastagbélhám sejtkinetikai változásainak vizsgálata gyulladásos vastagbélbetegségekben a gyulladás szövettani aktivitásának függvényében Doktori (PhD) dolgozat Gastroenterológia c. PhD program keretében

Részletesebben

Áttekintő. Hormonterápia 2/3. Hormonterápia 1/3. Hormonterápia 3/3. Emlő 2014.10.20. Tumorprogresszió és előrejelzése Dr.

Áttekintő. Hormonterápia 2/3. Hormonterápia 1/3. Hormonterápia 3/3. Emlő 2014.10.20. Tumorprogresszió és előrejelzése Dr. Áttekintő Tumorprogresszió és előrejelzése Dr. Győrffy Balázs 1. 2. Emlő tu. SM Aromatáz inhibitorok 3. tu. 4. Biomarkerek PR 5. Ajánlások 1/3 Malignus transzformáció receptorok megtartása Beatson, 1896

Részletesebben

Áttekintés az emlőrák megbetegedések és a gyógyítás helyzetéről Magyarországon beleértve a 2001 óta folyó mammográfiás szűréseket. Dr.

Áttekintés az emlőrák megbetegedések és a gyógyítás helyzetéről Magyarországon beleértve a 2001 óta folyó mammográfiás szűréseket. Dr. Áttekintés az emlőrák megbetegedések és a gyógyítás helyzetéről Magyarországon beleértve a 2001 óta folyó mammográfiás szűréseket. Dr. Kovács Attila 1 Emlőrák Világszerte a 5. leggyakoribb rák nőkben (valamennyi

Részletesebben

HER2 immunhisztokémiai vizsgálatok minôségellenôrzése

HER2 immunhisztokémiai vizsgálatok minôségellenôrzése HER2 immunhisztokémiai vizsgálatok minôségellenôrzése Egy magyarországi körvizsgálat eredményei Eredeti közlemény Cserni Gábor 1, Kálmán Ede 2, Kulka Janina 3, Orosz Zsolt 4, Udvarhelyi Nóra 4, Krenács

Részletesebben

Téli kedvezményes ajánlataink

Téli kedvezményes ajánlataink Téli kedvezményes ajánlataink Ajánlataink 2017 január 31-ig érvényesek! BIOBASE műszerek a NucleotestBio Kft. kínálatában! Steril box-ok, lamináris box-ok: Hűtők, fagyasztók, ultramélyhűtők, autoklávok,

Részletesebben

Kettős férfi emlőrák és a beteg utógondozása

Kettős férfi emlőrák és a beteg utógondozása Bevezetés A férfi emlőrák ritka betegség, általában 100 női emlőrákra jut egy férfi emlőrákos beteg. Egyes populációkban ez az arány más lehet, így például az afrikai fekete lakosság körében 2,4% (1).

Részletesebben

Diagnózis és prognózis

Diagnózis és prognózis Diagnózis, prognózis Általános vizsgálat Diagnózis és prognózis Fizikális vizsgálat Endoszkópia Képalkotás Sebészi feltárás A kezelés megválasztása Specifikus elemzés Kórszövettan/citológia Klinikai kémia

Részletesebben

RÉSZLETES BESZÁMOLÓ Az OTKA által támogatott konzorcium működésében az Uzsoki utcai Kórház feladata a szövetminták gyűjtése, előzetes feldolgozása, ill. a betegek utánkövetése, valamint az utánkövétésre

Részletesebben

Platina bázisú kemoterápia hatása különböző biomarkerek expressziójára tüdőrákokban

Platina bázisú kemoterápia hatása különböző biomarkerek expressziójára tüdőrákokban Platina bázisú kemoterápia hatása különböző biomarkerek expressziójára tüdőrákokban Pápay J. 1, Sápi Z. 1 Gyulai M. 5, Egri G. 2, Szende B. 1, Tímár J. 4 Moldvay J. 3 1: Semmelweis Egyetem, I.sz.Patológiai

Részletesebben

Retinoid X Receptor, egy A-vitamin szenzor a tüdőmetasztázis kontrolljában. Kiss Máté!

Retinoid X Receptor, egy A-vitamin szenzor a tüdőmetasztázis kontrolljában. Kiss Máté! Retinoid X Receptor, egy A-vitamin szenzor a tüdőmetasztázis kontrolljában Kiss Máté! Magreceptor Kutató Laboratórium Biokémiai és Molekuláris Biológiai Intézet Debreceni Egyetem, Általános Orvostudományi

Részletesebben

KLINIKAI ÉS EGÉSZSÉG- GAZDASÁGTANI EVIDENCIÁK A VASTAGBÉLSZŰRÉSBEN

KLINIKAI ÉS EGÉSZSÉG- GAZDASÁGTANI EVIDENCIÁK A VASTAGBÉLSZŰRÉSBEN Vastagbélszűrési disszeminációs workshop Szeged, 2015. május 12. KLINIKAI ÉS EGÉSZSÉG- GAZDASÁGTANI EVIDENCIÁK A VASTAGBÉLSZŰRÉSBEN Prof. Dr. Boncz Imre PTE ETK Egészségbiztosítási Intézet AZ ELŐADÁS TÉMÁJA

Részletesebben

A vesedaganatok sebészi kezelése

A vesedaganatok sebészi kezelése A vesedaganatok sebészi kezelése Szendrői Attila Semmelweis Egyetem, Urológiai Klinika és Uroonkológiai Centrum Az Európai Urológus Testület képzőhelye Robson elvek (1963) Nincs szisztémás kezelés -radikális

Részletesebben

HER2-gátló kezelés lehetõségei progresszió után metasztatikus emlõrákban

HER2-gátló kezelés lehetõségei progresszió után metasztatikus emlõrákban HER2-gátló kezelés lehetõségei progresszió után metasztatikus emlõrákban Dank Magdolna Szenológiai Kongresszus 2009 1 HER2-gátlás metasztatikus emlõrákban A HER2 overexpresszió egy korai esemény az emlõrák

Részletesebben

A proteomika új tudománya és alkalmazása a rákdiagnosztikában

A proteomika új tudománya és alkalmazása a rákdiagnosztikában BIOTECHNOLÓGIAI FEJLESZTÉSI POLITIKA, KUTATÁSI IRÁNYOK A proteomika új tudománya és alkalmazása a rákdiagnosztikában Tárgyszavak: proteom; proteomika; rák; diagnosztika; molekuláris gyógyászat; biomarker;

Részletesebben

Szakmai zárójelentés

Szakmai zárójelentés Szakmai zárójelentés A témavezető neve: dr. Antus Balázs A téma címe: A bronchiolitis obliterans szindróma pathomechanizmusa OTKA nyilvántartási szám: F 046526 Kutatási időtartam: 2004-2008. A kutatási

Részletesebben

Daganatok kialakulásában szerepet játszó molekuláris folyamatok

Daganatok kialakulásában szerepet játszó molekuláris folyamatok Daganatok kialakulásában szerepet játszó molekuláris folyamatok Genetikai változások Onkogének Tumorszuppresszor gének DNS hibajavító gének Telomer és telomeráz Epigenetikai változások DNS-metiláció Mikro-RNS

Részletesebben

San Antonio Breast Cancer Symposium. Dr. Tőkés Tímea

San Antonio Breast Cancer Symposium. Dr. Tőkés Tímea San Antonio Breast Cancer Symposium Dr. Tőkés Tímea San Antonio, Texas, USA Henry B. Gonzalez Convention Center December 10-14, 2013 SABCS 2013 Több, mint 7500 résztvevő, több, mint 70 országból Továbbképzések,

Részletesebben

X PMS 2007 adatgyűjtés eredményeinek bemutatása X PMS ADATGYŰJTÉS

X PMS 2007 adatgyűjtés eredményeinek bemutatása X PMS ADATGYŰJTÉS X PMS ADATGYŰJTÉS 2007 1 Tartalom Összefoglalás...3 A kutatásba beválasztott betegek életkora... 4 A kutatásba bevont betegek nem szerinti megoszlása... 5 Az adatgyűjtés során feltárt diagnózisok megoszlása...

Részletesebben

MAGYOT évi Tudományos Szimpóziuma Május 5-6, Budapest

MAGYOT évi Tudományos Szimpóziuma Május 5-6, Budapest MAGYOT 2017. évi Tudományos Szimpóziuma Május 5-6, Budapest A petefészekrákok kezelésében nem régen került bevezetésre egy újabb fenntartó kezelés BRCA mutációt hordozó (szomatikus vagy germinális) magas

Részletesebben

Gyors szövetazonosítás membránalkotók tömegspektrometriás vizsgálatával egy új technológia tumorok azonosítására műtét közben.

Gyors szövetazonosítás membránalkotók tömegspektrometriás vizsgálatával egy új technológia tumorok azonosítására műtét közben. Gyors szövetazonosítás membránalkotók tömegspektrometriás vizsgálatával egy új technológia tumorok azonosítására műtét közben doktori (PhD) értekezés tézisei Balog Júlia Eötvös Loránd Tudományegyetem,

Részletesebben

DOKTORI ÉRTEKEZÉS TÉZISEI AZ OPPORTUNISTA HUMÁNPATOGÉN CANDIDA PARAPSILOSIS ÉLESZTŐGOMBA ELLENI TERMÉSZETES ÉS ADAPTÍV IMMUNVÁLASZ VIZSGÁLATA

DOKTORI ÉRTEKEZÉS TÉZISEI AZ OPPORTUNISTA HUMÁNPATOGÉN CANDIDA PARAPSILOSIS ÉLESZTŐGOMBA ELLENI TERMÉSZETES ÉS ADAPTÍV IMMUNVÁLASZ VIZSGÁLATA DOKTORI ÉRTEKEZÉS TÉZISEI AZ OPPORTUNISTA HUMÁNPATOGÉN CANDIDA PARAPSILOSIS ÉLESZTŐGOMBA ELLENI TERMÉSZETES ÉS ADAPTÍV IMMUNVÁLASZ VIZSGÁLATA TÓTH ADÉL TÉMAVEZETŐ: DR. GÁCSER ATTILA TUDOMÁNYOS FŐMUNKATÁRS

Részletesebben

BUDAPEST 2006. május 4-6. V. Magyar Sejtanalitikai Konferencia Molekuláris medicina: Sejtanalitika Innováció Alkalmazás ÉRTESÍTÔ

BUDAPEST 2006. május 4-6. V. Magyar Sejtanalitikai Konferencia Molekuláris medicina: Sejtanalitika Innováció Alkalmazás ÉRTESÍTÔ BUDAPEST 2006. május 4-6. V. Magyar Sejtanalitikai Konferencia Molekuláris medicina: Sejtanalitika Innováció Alkalmazás ÉRTESÍTÔ V. M A G Y A R S E J T A N A L I T I K A I K O N F E R E N C I A M O L E

Részletesebben

EGFR-tirozinkináz-inhibitorok alkalmazása tüdőrákban: szenzitivitás és rezisztencia

EGFR-tirozinkináz-inhibitorok alkalmazása tüdőrákban: szenzitivitás és rezisztencia 38 Gyógyszergyári közlemény EGFR-tirozinkináz-inhibitorok alkalmazása tüdőrákban: szenzitivitás és rezisztencia Moldvay Judit 1, Peták István 2,3 1 Semmelweis Egyetem Pulmonológiai Klinika, 2 Semmelweis

Részletesebben

Report on the main results of the surveillance under article 11 for annex II, IV and V species (Annex B)

Report on the main results of the surveillance under article 11 for annex II, IV and V species (Annex B) 0.1 Member State HU 0.2.1 Species code 2633 0.2.2 Species name Mustela eversmanii 0.2.3 Alternative species scientific name 0.2.4 Common name molnárgörény 1. National Level 1.1 Maps 1.1.1 Distribution

Részletesebben

Sentinel nyirokcsomó biopszia szájüregi laphámrák esetén

Sentinel nyirokcsomó biopszia szájüregi laphámrák esetén Sentinel nyirokcsomó biopszia szájüregi laphámrák esetén Dr. Patkó Tamás, dr. Koltai Pál, dr. Remenár Éva, dr. Boér András Országos Onkológiai Intézet Fej-nyak-állcsont és Rekonstrukciós Sebészeti Osztály

Részletesebben

E4 A Gyermekkori szervezett lakossági emlőszűrések hatása az emlőműtétek

E4 A Gyermekkori szervezett lakossági emlőszűrések hatása az emlőműtétek 08.30-09.30 09.00-10.30 Pátria terem 2005. november 10. csütörtök E1 MEGNYITÓ E2 1.Nemzeti Üléselnökök: Rákkontroll Kovács Attila, Program Csonka I. Csaba, Ottó Szabolcs E3 Kásler Ottó jellegzetességei,

Részletesebben

Nemzeti Onkológiai Kutatás-Fejlesztési Konzorcium a daganatos halálozás csökkentésére

Nemzeti Onkológiai Kutatás-Fejlesztési Konzorcium a daganatos halálozás csökkentésére Nemzeti Kutatási és Fejlesztési Program 1. Főirány: Életminőség javítása Nemzeti Onkológiai Kutatás-Fejlesztési Konzorcium a daganatos halálozás csökkentésére 1/48/2001 Zárójelentés: 2001. május 15.-2004.

Részletesebben

AZ ALACSONY HŐMÉRSÉKLET HATÁSÁRA BEKÖVETKEZŐ REDOX ÉS GÉNEXPRESSZIÓS VÁLTOZÁSOK GABONAFÉLÉKBEN

AZ ALACSONY HŐMÉRSÉKLET HATÁSÁRA BEKÖVETKEZŐ REDOX ÉS GÉNEXPRESSZIÓS VÁLTOZÁSOK GABONAFÉLÉKBEN A martonvásári agrárkutatások hatodik évtizede AZ ALAONY HŐMÉRSÉKLET HATÁSÁRA BEKÖVETKEZŐ REDOX ÉS GÉNEXPRESSZIÓS VÁLTOZÁSOK GABONAFÉLÉKBEN KOY GÁBOR, VÁGÚJFALVI ATTILA, TÓTH BALÁZS, SZALAI GABRIELLA,

Részletesebben

MikroRNS-ek expressziós mintázatának és patogenetikai szerepének vizsgálata a mellékvese daganataiban

MikroRNS-ek expressziós mintázatának és patogenetikai szerepének vizsgálata a mellékvese daganataiban MikroRNS-ek expressziós mintázatának és patogenetikai szerepének vizsgálata a mellékvese daganataiban Doktori tézisek Dr. Tömböl Zsófia Semmelweis Egyetem Klinikai Orvostudományok Doktori Iskola Programvezető:

Részletesebben

Roche Personalised Healthcare Megfelelő kezelést az egyénnek 2009 szeptember 9

Roche Personalised Healthcare Megfelelő kezelést az egyénnek 2009 szeptember 9 Roche Personalised Healthcare Megfelelő kezelést az egyénnek 2009 szeptember 9 dr Kollár György Elvárás az egészségügytől Több hatékonyabb és biztonságosabb gyógyszer legyen elérhető 80 Kezelésre válaszolók

Részletesebben

A sejtfelszíni FasL és szolubilis vezikulakötött FasL által indukált sejthalál gátlása és jellemzése

A sejtfelszíni FasL és szolubilis vezikulakötött FasL által indukált sejthalál gátlása és jellemzése A sejtfelszíni FasL és szolubilis vezikulakötött FasL által indukált sejthalál gátlása és jellemzése Doktori értekezés tézisei Hancz Anikó Témavezetők: Prof. Dr. Sármay Gabriella Dr. Koncz Gábor Biológia

Részletesebben

Nőgyógyászati daganatok carcinogenesis, szignálutak, célzott terápiák

Nőgyógyászati daganatok carcinogenesis, szignálutak, célzott terápiák Nőgyógyászati daganatok carcinogenesis, szignálutak, célzott terápiák Tóth Erika Sebészeti és Molekuláris Patológiai Osztály Országos Onkológiai Intézet Az előadás vázlata 1. Célzott terápia definíció

Részletesebben

Report on the main results of the surveillance under article 11 for annex II, IV and V species (Annex B)

Report on the main results of the surveillance under article 11 for annex II, IV and V species (Annex B) 0.1 Member State HU 0.2.1 Species code 1357 0.2.2 Species name Martes martes 0.2.3 Alternative species scientific name 0.2.4 Common name nyuszt 1. National Level 1.1 Maps 1.1.1 Distribution Map Yes 1.1.1a

Részletesebben