befolyásol soló hormon Miseta Attila, Tudományegyetem

Save this PDF as:

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "befolyásol soló hormon Miseta Attila, Tudományegyetem"


1 A hepcidin: egy új, a vas-transzportot befolyásol soló hormon Miseta Attila, Laboratóriumi riumi Medicina Intézet, ÁOK, Pécsi Tudományegyetem H-7624 Pécs, 13. Ifjúság Str. HUNGARY

2 Hepcidin A hepcidin a vasanyagcserében közvetlenül involvált egyedüli hormon. Hepcidin hatására a ferroportin receptorokhoz kötött vas internalizálódik. Ez olyan módon történik, hogy a hepcidin gátolja a ferroportint, ami normálisan a sejtbıl távolítja el a vasat. Következésképpen a sejten belüli vas raktárak töltıdnek, míg a szérum vas csökken. A hormon hasonlóan más peptid hormonokhoz- hosszabb prekurzor (preprohormon) formájában keletkezik (84AA) ami egy 60AA hosszúságú prohormonná alakul. Az érett hormon hossza 25AA. A folyamatban szerin peptidázok (furin) játssza a fı szerepet. Érdekes módon azonban a periférián is megtalálható jelentıs mennyiségő prohormon. a b c d MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRR DTHFPICIFCCGCCHRSKCGMCCKT Signal region Hep-84 Hep-20 Hep-25

3 Hepcidin Antibakteriális hatású peptideket keresve két kutatócsoport is ugyanazon peptidre talált. Thomas Ganz és csoportja vizeletbıl izolálta. Adermann és társai a szérum ultrafiltrátumban találták meg. Mindkét csoport mint a májban termelıdı antimikrobiális hatású peptidet azonosította az ezredforduló idején. (Érdekes módon a a szervezetben szaporódó pathogén kórokozók egy része erısen vas dependens, így a szérum vas csökkenése elınytelenül hat rájuk. A hepcidin antifungális hatása valószínősíthetı, de antibakteriális hatását többen megkérdıjelezik.) Ugyanakkor a hepcidin legjelentısebb hatása valószínőleg a vasháztartás hormonális regulációja. A hepcidint expresszáló tumor esetében pl. súlyos anémia léphet fel. Valószínősíthetı, hogy az ismeretlen eredető vagy krónikus gyulladásos állapotokban jelentkezı vérszegénységek egy részének a hátterében is citokin indukálta fokozott hepcidin expresszió és hatás áll.

4 Hepcidin A ferroportin nagy mennyiségben az enterocytákban, makrofágokban és májsetekben expresszálódik. Ennek megfelelıen a ferroportin gátlás az enterocytákban a vas felszívódását lassítja. A makrofágokban és májsejtekben pedig a vasraktárakat növeli, a vas kibocsájtását lassítja. Összeségében a sejt vasraktározás fokozása (hepato- és enterocyták) és a felszívódás gátlása a szérum vasat csökkentı hatásúak.

5 Hepcidin laboratóriumi riumi diagnosztika Sajnos a hepcidin mérése nem egyszerő. Általában prohepcidin ELISA kitek érhetık el. Az eredmények nem kielégítıek. A prohepcidin szintek és a vasháztartás különféle zavarai nem függenek szorosan össze. A közelmúltban jelent meg az elsı hepcidin ELISA kit. Diagnosztikus értéke még nem igazolt.

6 Milyen fehérj rjék védik (esetleg) a prepro- és prohepcidineket az érett formává tört rténı átalakul talakulást stól? Bakteriális két hibrid rendszer: egy - egy plazmid lacz és carbenicillin rezisztencia géneket tartalmaz. A gének akkkor íródnak aktívan át, ha a két plazmid által kódolt csali ill. cél fehérjék egymással kapcsolatban kerülnek. Az eredmény lemérhetı olyan módon, hogy a sejtek carbenicillin rezisztensek lesznek és laktóz bontó aktivitást mutatnak. Target protein Swiss-Prot no. Function Localization Transthyretin P02766 Thyroid hormone binding Secreted to plasma a-1 Acid protein P02763 Acute-phase protein Secreted to plasma a -1 Antitrypsin P01009 Serine protease inhibitor Secreted to plasma CytochromeP450 P05181 Drug metabolism Membrane protein ATP ADP translocase P12235 ATP ADP exchange Mitochondrion Enoyl-CoA hydratase P30084 Fatty acid oxidation Mitochondrion

7 Az A1AT interakciói i a hepcidinnel és elılaalakjaival laalakjaival Insert in pbt Insert in ptrg Growth on CTCK plates Preprohepcidin a-1 Antitrypsin +++ Prohepcidin a-1 Antitrypsin +++ Hepcidin a-1 Antitrypsin - Colony growth was classified as follows: - no growth; +++ strong growth.

8 In vitro elúci ciós esszé az A1AT és preprohepcidin interakciójának nak bizonyítására Glutathion Sepharose (GST) gyöngyök felszinére GST, vagy GST-preprohepcidin fúziós fehérje asszociál. A fúziós fehérje elúciója után vizsgáljuk, hogy az hoz-e magával A1AT-t. (Western blott anti-a1at IgG-vel.) A, a, pozitív kontrol: A1AT-t expresszáló sejtek (BL21) lizátuma b, negatív kontrol: A1AT lizátum + GST gyöngyök c, A1AT lizátum + GST-preprohepcidin gyöngyök B, a, emberi szérum + GST gyöngyök b, emberi szérum + GST-preprohepcidin gyöngyök

9 A preprohepcidin expessziója és annak gátl tlása azonos irány nyú változ ltozásokat okoz az A1AT expressziójában

10 A prohepcidin kötıdik a fehérj rjékhez a szérumban, ill. A1AT fokozza a kötıdést Ultrafiltrációs kísérletet követıen prohepcidint mértünk ELISA-val. +A1AT

11 A prohepcidin A1AT vel ko-immunoprecipit immunoprecipitálódik az emberi szérumb rumból CNBr aktivált Sepharose 4B gyöngyökhöz anti- A1AT- IgG-t kötöttünk, majd inkubáltuk a, szérum ultrafiltrátumban (negatív kontrol, csak szabad prohepcidin, b, szintetikus prohepcidinnel (pozitív kontrol) c, szérumban Az immunreakcióban anti-hepcidin ellenanyagot használtunk.

12 Tömegspektrometri megspektrometriás s profil az affinitás tisztított tott mintáról kontrol Zip tip affinitás tisztított szérum minta

13 Kösz szönöm a figyelemet!

A hepcidin szerepe a vas anyagcseréjében: lehetséges új aspektusok. Laboratóriumi Medicina Intézet, PTE, Klinikai Központ Pécs, Ifjúság u. 13.

A hepcidin szerepe a vas anyagcseréjében: lehetséges új aspektusok. Laboratóriumi Medicina Intézet, PTE, Klinikai Központ Pécs, Ifjúság u. 13. A hepcidin szerepe a vas anyagcseréjében: lehetséges új aspektusok Miseta Attila, Pandur Edina, Fekete Zsuzsanna, Nagy Judit, Sipos Katalin Laboratóriumi Medicina Intézet, PTE, Klinikai Központ Pécs, Ifjúság


A Flowcytometriás. en. Sinkovichné Bak Erzsébet,

A Flowcytometriás. en. Sinkovichné Bak Erzsébet, A Flowcytometriás keresztpróba jelentısége élıdonoros veseátültet ltetést megelızıen. en. Sinkovichné Bak Erzsébet, Schmidt Lászlóné Mikor végezhetv gezhetı el a veseátültet ltetés? Veseátültetés s akkor



OTKA ZÁRÓJELENTÉS NF-κB aktiváció % Annexin pozitív sejtek, 24h kezelés OTKA 613 ZÁRÓJELENTÉS A nitrogén monoxid (NO) egy rövid féléletidejű, számos szabályozó szabályozó funkciót betöltő molekula, immunmoduláns hatása


Immunológia alapjai. 16. előadás. Komplement rendszer

Immunológia alapjai. 16. előadás. Komplement rendszer Immunológia alapjai 16. előadás Komplement rendszer A gyulladás molekuláris mediátorai: Plazma enzim mediátorok: - Kinin rendszer - Véralvadási rendszer Lipid mediátorok Kemoattraktánsok: - Chemokinek:


Receptorok és szignalizációs mechanizmusok

Receptorok és szignalizációs mechanizmusok Molekuláris sejtbiológia: Receptorok és szignalizációs mechanizmusok Dr. habil Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immunbiológiai Intézet Sejtek szignalizációs kapcsolatai Sejtek szignalizációs


Glikolízis. emberi szervezet napi glukózigénye: kb. 160 g

Glikolízis. emberi szervezet napi glukózigénye: kb. 160 g Glikolízis Minden emberi sejt képes glikolízisre. A glukóz a metabolizmus központi tápanyaga, minden sejt képes hasznosítani. glykys = édes, lysis = hasítás emberi szervezet napi glukózigénye: kb. 160



VIZSGÁLATA FLOWCYTOMETRIA TERÁPIAREZISZTENCIA FEHÉRJ RJÉK K MŐKÖDÉSÉNEK M VIZSGÁLATA FLOWCYTOMETRIA ALKALMAZÁSÁVAL Szendi Eszter V. évfolyam Témavezetı: Dr. Vajdovich Péter TDK konferencia, 2008.11.26. Terápiarezisztencia alapvetı


Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás.

Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Az immunrendszer felépítése Veleszületett immunitás (komplement, antibakteriális


A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban

A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban Doktori (PhD) értekezés Siklódi Erika Rozália Biológia Doktori Iskola Iskolavezető: Prof. Erdei Anna, tanszékvezető egyetemi


Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia

Fehérje expressziós rendszerek. Gyógyszerészi Biotechnológia Fehérje expressziós rendszerek Gyógyszerészi Biotechnológia Expressziós rendszerek Cél: rekombináns fehérjék előállítása nagy tisztaságban és nagy mennyiségben kísérleti ill. gyakorlati (therapia) felhasználásokra


Lehetıségek a thrombosis prophylaxis és kezelés hatékonyságának monitorozásában

Lehetıségek a thrombosis prophylaxis és kezelés hatékonyságának monitorozásában Lehetıségek a thrombosis prophylaxis és kezelés hatékonyságának monitorozásában Tıkés-Füzesi Margit PTE ÁOK Laboratóriumi Medicina Intézete, Pécs Aspirin(ASA) non responder betegek 30-40%a További kezelési


Immunológia alapjai. Az immunválasz szupressziója Előadás. A szupresszióban részt vevő sejtes és molekuláris elemek

Immunológia alapjai. Az immunválasz szupressziója Előadás. A szupresszióban részt vevő sejtes és molekuláris elemek Immunológia alapjai 19 20. Előadás Az immunválasz szupressziója A szupresszióban részt vevő sejtes és molekuláris elemek Mi a szupresszió? Általános biológiai szabályzó funkció. Az immunszupresszió az


Vásárhelyi Barna. Semmelweis Egyetem, Laboratóriumi Medicina Intézet. Az ösztrogénekimmunmoduláns hatásai

Vásárhelyi Barna. Semmelweis Egyetem, Laboratóriumi Medicina Intézet. Az ösztrogénekimmunmoduláns hatásai Vásárhelyi Barna Semmelweis Egyetem, Laboratóriumi Medicina Intézet Az ösztrogénekimmunmoduláns hatásai Ösztrogénhatások Ösztrogénhatások Morbiditás és mortalitási profil eltérő nők és férfiak között Autoimmun


B-sejtek szerepe az RA patológiás folyamataiban

B-sejtek szerepe az RA patológiás folyamataiban B-sejtek szerepe az RA patológiás folyamataiban Erdei Anna Biológiai Intézet Immunológiai Tanszék Eötvös Loránd Tudományegyetem Immunológiai Tanszék ORFI, Helia, 2015 április 17. RA kialakulása Gary S.


A preventív vakcináció lényege :

A preventív vakcináció lényege : Vakcináció Célja: antigénspecifkus immunválasz kiváltása a szervezetben A vakcina egy olyan készítmény, amely fokozza az immunitást egy adott betegséggel szemben (aktiválja az immunrendszert). A preventív


Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése

Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése Doktori tézisek Dr. Cserepes Judit Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


Tények a Goji bogyóról:

Tények a Goji bogyóról: Tények a Goji bogyóról: 19 aminosavat (a fehérjék építőkövei) tartalmaz, melyek közül 8 esszenciális, azaz nélkülözhetelen az élethez. 21 nyomelemet tartalmaz, köztük germániumot, amely ritkán fordul elő


Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből.

Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Vércukorszint szabályozása: Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Szövetekben monoszacharid átalakítás enzimjei: Szénhidrát anyagcserében máj központi szerepű. Szénhidrát


Intraoperatív és sürgıs endokrin vizsgálatok. Kıszegi Tamás Pécsi Tudományegyetem Laboratóriumi Medicina Intézet

Intraoperatív és sürgıs endokrin vizsgálatok. Kıszegi Tamás Pécsi Tudományegyetem Laboratóriumi Medicina Intézet Intraoperatív és sürgıs endokrin vizsgálatok Kıszegi Tamás Pécsi Tudományegyetem Laboratóriumi Medicina Intézet Sürgıs vizsgálatok elérhetısége Elvben minden vizsgálat lehet sürgıs! Non-stop elérhetıség


a NAT-1-1678/2012 nyilvántartási számú akkreditált státuszhoz

a NAT-1-1678/2012 nyilvántartási számú akkreditált státuszhoz Nemzeti Akkreditáló Testület RÉSZLETEZÕ OKIRAT a NAT-1-1678/2012 nyilvántartási számú akkreditált státuszhoz Az Országos Epidemiológiai Központ Bakteriológiai Mikológiai Parazitológiai és Tipizáló fõosztály


Glucagon. A-sejtekben termelődik (+ GI és CNS L sejtjei) Egyláncú peptid, MW: 3,500; aa:29. preprohormon MW: 18,000 prohormon (glycentin) MW: 12,000

Glucagon. A-sejtekben termelődik (+ GI és CNS L sejtjei) Egyláncú peptid, MW: 3,500; aa:29. preprohormon MW: 18,000 prohormon (glycentin) MW: 12,000 Glucagon A-sejtekben termelődik (+ GI és CNS L sejtjei) Egyláncú peptid, MW: 3,500; aa:29 preprohormon MW: 18,000 prohormon (glycentin) MW: 12,000 Szignalizáció: camp (Gs) Additív hatás katekolaminokkal


A rák, mint genetikai betegség

A rák, mint genetikai betegség A rák, mint genetikai betegség Diák: Ferencz Arnold-Béla la Felkész szítı tanár: József J Éva Bolyai Farkas Elméleti leti LíceumL Mi is a rák r tulajdonképpen? A rák r k egy olyan betegség g ahol sejt


A kemotaxis kiváltására specializálódott molekula-család: Cytokinek

A kemotaxis kiváltására specializálódott molekula-család: Cytokinek A kemotaxis kiváltására specializálódott molekula-család: Cytokinek Cytokinek - definíció Cytokin (Cohen 1974): Sejtek közötti kémi miai kommunikációra alkalmas anyagok; legtöbbjük növekedési vagy differenciációs


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


Egy sikeres akkreditálás eredményei

Egy sikeres akkreditálás eredményei Az akkreditált státusz tusz gúzsba g köt? k Egy sikeres akkreditálás eredményei és s tanulságai Tölgyfa Margit, Liszt Ferenc, Kovács L. GáborG Pécsi Tudományegyetem, Klinikai Központ, K Laboratóriumi riumi


A vasanyagcserét szabályozó hormon, a hepcidin interakciói és autoregulációja

A vasanyagcserét szabályozó hormon, a hepcidin interakciói és autoregulációja Doktori (PhD) értekezés A vasanyagcserét szabályozó hormon, a hepcidin interakciói és autoregulációja Pandur Edina Doktori Iskola: Klinikai Orvostudományok Doktori Iskola vezetője: Prof. Dr. Komoly Sámuel


Katasztrófális antifoszfolipid szindróma

Katasztrófális antifoszfolipid szindróma Katasztrófális antifoszfolipid szindróma Gadó Klára Semmelweis Egyetem, Belgyógyászati Klinika Antifoszfolipid szindróma Artériás és vénás thrombosis Habituális vetélés apl antitest jelenléte Mi


Dr. Nemes Nagy Zsuzsa Szakképzés Karl Landsteiner Karl Landsteiner:

Dr. Nemes Nagy Zsuzsa Szakképzés Karl Landsteiner Karl Landsteiner: Az AB0 vércsoport rendszer Dr. Nemes Nagy Zsuzsa Szakképzés 2011 Az AB0 rendszer felfedezése 1901. Karl Landsteiner Landsteiner szabály 1901 Karl Landsteiner: Munkatársai vérmintáit vizsgálva fedezte fel


Tüdő adenocarcinomásbetegek agyi áttéteiben jelenlévő immunsejtek, valamint a PD-L1 és PD-1 fehérjék túlélésre gyakorolt hatása

Tüdő adenocarcinomásbetegek agyi áttéteiben jelenlévő immunsejtek, valamint a PD-L1 és PD-1 fehérjék túlélésre gyakorolt hatása Tüdő adenocarcinomásbetegek agyi áttéteiben jelenlévő immunsejtek, valamint a és PD-1 fehérjék túlélésre gyakorolt hatása Téglási Vanda, MoldvayJudit, Fábián Katalin, Csala Irén, PipekOrsolya, Bagó Attila,





A talaj szerves anyagai

A talaj szerves anyagai A talaj szerves anyagai a talajban elıfordul forduló összes szerves eredető anyagok a talaj élılényei (élı biomassza), a talajban élı növények nyek gyökérzete rzete, az elhalt növényi n nyi és állati maradványok


Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás.

Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Antigén felismerés Az ellenanyagok és a B sejt receptorok natív formában


A ferrilhemoglobin szerepe az LDL oxidációjában

A ferrilhemoglobin szerepe az LDL oxidációjában A ferrilhemoglobin szerepe az LDL oxidációjában MTA-DEOEC Hemosztázis,Trombózis és Vaszkuláris Biológiai Kutató Csoport Belgyógyászati, Gyermekgyógyászati Intézet Vaszkuláris Biológiai Kutató Laboratórium


Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az


Norvég Finanszírozási Mechanizmus által támogatott projekt HU-0115/NA/2008-3/ÖP-9 ÚJ TERÁPIÁS CÉLPONTOK AZONOSÍTÁSA GENOMIKAI MÓDSZEREKKEL



Az immunrendszer működésében résztvevő sejtek Erdei Anna Immunológiai Tanszék ELTE

Az immunrendszer működésében résztvevő sejtek Erdei Anna Immunológiai Tanszék ELTE Az immunrendszer működésében résztvevő sejtek Erdei Anna Immunológiai Tanszék ELTE Tanárszakosok, 2017. Bev. 2. ábra Az immunválasz kialakulása 3.1. ábra A vérsejtek képződésének helyszínei az élet folyamán


Az Oxidatív stressz hatása a PIBF receptor alegységek összeszerelődésére.

Az Oxidatív stressz hatása a PIBF receptor alegységek összeszerelődésére. Újabban világossá vált, hogy a Progesterone-induced blocking factor (PIBF) amely a progesteron számos immunológiai hatását közvetíti, nem csupán a lymphocytákban és terhességgel asszociált szövetekben,


Autoimmun vizsgálatok (ML AU)

Autoimmun vizsgálatok (ML AU) mennyisége Autoimmun vizsgálatok (ML AU) ML AU 1.100 ANA ELISA(QuantaLite) ELISA - Szérum 200 l < 20 U/ml ML AU 1.200 Anti-dsDNA ELISA Szérum 200 l < 20 IU/ml ML AU 1.210 Anti-dsDNA IgG (Alegria) ELISA



TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL Az egyes biomolekulák izolálása kulcsfontosságú a biológiai szerepük tisztázásához. Az affinitás kromatográfia egyszerűsége, reprodukálhatósága


Bioinformatika 2 10.el

Bioinformatika 2 10.el 10.el őadás Prof. Poppe László BME Szerves Kémia és Technológia Tsz. Bioinformatika proteomika Előadás és gyakorlat 2009. 04. 24. Genomikavs. proteomika A genomika módszereivel nem a tényleges fehérjéket


Leukotriénekre ható molekulák. Eggenhofer Judit OGYÉI-OGYI

Leukotriénekre ható molekulák. Eggenhofer Judit OGYÉI-OGYI Leukotriénekre ható molekulák Eggenhofer Judit OGYÉI-OGYI Mik is azok a leukotriének? Honnan ered az elnevezésük? - először a leukocitákban mutatták ki - kémiai szerkezetükből vezethető le - a konjugált

Részletesebben Tumor immunológia Tumor immunológia Tumor immunológia A tumorok és az immunrendszer kapcsolatai Tumorspecifikus és tumorasszociált antigének A tumor sejteket ölő sejtek és mechanizmusok Az immunológiai felügyelet


Lymphoma sejtvonalak és gyerekkori leukémia (ALL) sejtek mikro RNS (mir) profiljának vizsgálata

Lymphoma sejtvonalak és gyerekkori leukémia (ALL) sejtek mikro RNS (mir) profiljának vizsgálata Lymphoma sejtvonalak és gyerekkori leukémia (ALL) sejtek mikro RNS (mir) profiljának vizsgálata Dr. Nemes Karolina, Márk Ágnes, Dr. Hajdu Melinda, Csorba Gézáné, Dr. Kopper László, Dr. Csóka Monika, Dr.


Összes laborvizsgálat

Összes laborvizsgálat Összes laborvizsgálat Vérvétel díja 1 500 Ft 1 V. faktor Leiden- mutáció vérvétel 12. heti labor (induló/syphilis/hbsag) 18 000 Ft 17 ketoszteroid ürítés (Labor) 24. heti labor (OGTT)+ vércsop+ea. 9 900


szerzett tapasztalataink

szerzett tapasztalataink Anti-CCP mérése során szerzett tapasztalataink Geider Viola,Piros Alfrédn dné Baranya Megyei KórhK rház z Klinikai és Mikrobiológiai Laboratórium rium MOLSZE Kongresszus Pécs 2009 Bevezetı A rheumatoid


A veleszületett (természetes) immunrendszer. PAMPs = pathogen-associated molecular patterns. A fajspecifikus szignálok hiányának felismerése

A veleszületett (természetes) immunrendszer. PAMPs = pathogen-associated molecular patterns. A fajspecifikus szignálok hiányának felismerése A veleszületett (természetes) immunrendszer PAMPs = pathogen-associated molecular patterns PRRs = pattern recognition receptors A fajspecifikus szignálok hiányának felismerése Eukariota sejtmembrán Az


avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest

avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest Iparilag alkalmazható szekvenciák, avagy az ipari alkalmazhatóság kérdése biotechnológiai tárgyú szabadalmi bejelentéseknél Dr. Győrffy Béla, Egis Nyrt., Budapest Neutrokin α - jelentős kereskedelmi érdekek


Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 7. előadás Immunizálás. Poliklonális és monoklonális ellenanyag előállítása, tisztítása, alkalmazása Az antigén (haptén + hordozó) sokféle specificitású ellenanyag


A membrán koleszterin és sziálsav szerepe az immunrendszer sejtjeinek működésében: vizsgálatok monoklonális ellenanyagok segítségével

A membrán koleszterin és sziálsav szerepe az immunrendszer sejtjeinek működésében: vizsgálatok monoklonális ellenanyagok segítségével A membrán koleszterin és sziálsav szerepe az immunrendszer sejtjeinek működésében: vizsgálatok monoklonális ellenanyagok segítségével Doktori értekezés tézisei Balogh Andrea Témavezetők: Dr. László Glória





Az alvadási rendszer fehérjéi. Kappelmayer János DE OEC, KBMPI

Az alvadási rendszer fehérjéi. Kappelmayer János DE OEC, KBMPI Az alvadási rendszer fehérjéi Kappelmayer János DE OEC, KBMPI Fehérje diagnosztika, Pécs, 2006 1. Az alvadási rendszer fehérjéinek áttekintése 2. Alvadási fehérje abnormalitások 3. Az alvadási rendszer


Immunológia alapjai. 23-24. előadás. Immunológiai tolerancia. Fiziológiás és patológiás autoimmunitás.

Immunológia alapjai. 23-24. előadás. Immunológiai tolerancia. Fiziológiás és patológiás autoimmunitás. Immunológia alapjai 23-24. előadás Immunológiai tolerancia. Fiziológiás és patológiás autoimmunitás. Tolerált bőr graftok MHC (H2) azonos egereken TOLERANCIA & AUTOIMMUNITÁS Toleranciáról beszélünk, ha


Kereskedelmi forgalomban lévő rekombináns gyógyszerkészítmények

Kereskedelmi forgalomban lévő rekombináns gyógyszerkészítmények Kereskedelmi forgalomban lévő rekombináns gyógyszerkészítmények Írta: Barta Zsolt Biomérnök hallgató 2007 Tartalomjegyzék 1 Rekombináns inzulin [1]... 3 2 A humán növekedési hormon rekombináns módon történő





A neuroendokrin jelátviteli rendszer

A neuroendokrin jelátviteli rendszer A neuroendokrin jelátviteli rendszer Hipotalamusz Hipofízis Pajzsmirigy Mellékpajzsmirigy Zsírszövet Mellékvese Hasnyálmirigy Vese Petefészek Here Hormon felszabadulási kaszkád Félelem Fertőzés Vérzés


és biztonságoss Prof. Dr. János J CHMP member Hungary

és biztonságoss Prof. Dr. János J CHMP member Hungary Gyógyszerek hatásoss sossága és biztonságoss gosságaga Prof. Dr. János J Borvendég CHMP member Hungary A ma gyógyszerkutat gyszerkutatásának legfontosabb célbetegségei: gei: malignus betegségek gek cardiovascularis



HUMAN IMMUNODEFICIENCY VIRUS (HIV) ÉS AIDS HUMAN IMMUNODEFICIENCY VIRUS (HIV) ÉS AIDS Dr. Mohamed Mahdi MD. MPH. Department of Infectology and Pediatric Immunology University of Debrecen 2010 Történelmi tények a HIV-ről 1981: Első megjelenés San


Ö Á Í Í ű ű ú ű ű ű ű ú ú ú ú ű ű ű ű ű ű ű ű ű ú ű ú ú ú ű ú Á ú ű ű Ó ú ű ű ű ú Ó ú ű ú É ú ú ú ű ű ú ű ú Ú Á ú É ú Ó ú ú ú ú ű ű ű ú É Á É É ű ű Í ú ú Ó Í ű Í ű ű ú ű ű ű É ű ú Á ű ű ú Í ű Á ű ú ú É


ö ö ö ö ö ö ö ű ű ö ö ö ö ö Ő ö Ó Ú ö Ö ö ö ö ö Ö Ő ö ö Í Ó Ó Ő ö ö ö ö ö Ő Ő Ó Ő É ö Ú ö ö Ő ö ö ö ö ö ö ö Ő ö Ő É ö Ő ö ö Ő ö ö ö Ó ű ö ö ö Ő ö ö ö Í Ő Ó Í ö ö ö ö Ő Ő Ő Ő Í Ó Ő Ő Í Ő ö ö ö ö ö Ő Ő ö


Ú ű ü ü Ü ű É É Ö Ö Á ü ü ü ű É ú Á Ö Ü ü ü ű É Á É Ű ű Ü Ü ű ü ű ü ű ü Ü ü ü Ű Á Á Á ű ú ű Á Ó Ó É Á Ó Á Ó ű ü ü ű ű ü ú ú ü ü ü ű ü ű Ü ű ü ü ú ü Ö ü ú ú ü ü ü ü ű ú ü Ó ü Ó Ó ü ü Ó ü ü Ó ű ű ú ű ű ü


Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 2. előadás A veleszületett és specifikus immunrendszer sejtjei Vérképzés = Haematopeiesis, differenciálódás Kék: ősssejt Sötétkék: éretlen sejtek Barna: érett


A KÉMIAI KOMMUNIKÁCIÓ ALAPELVEI. - autokrin. -neurokrin. - parakrin. -térátvitel. - endokrin

A KÉMIAI KOMMUNIKÁCIÓ ALAPELVEI. - autokrin. -neurokrin. - parakrin. -térátvitel. - endokrin A KÉMIAI KOMMUNIKÁCIÓ ALAPELVEI - autokrin -neurokrin - parakrin -térátvitel - endokrin 3.1. ábra: Az immunreakciók főbb típusai és funkciójuk. IMMUNVÁLASZ TERMÉSZETES ADAPTÍV humorális sejtes HUMORÁLIS


Immunológia 4. A BCR diverzitás kialakulása

Immunológia 4. A BCR diverzitás kialakulása Immunológia 4. A BCR diverzitás kialakulása 2017. október 4. Bajtay Zsuzsa A klónszelekciós elmélet sarokpontjai: Monospecifictás: 1 sejt 1-féle specificitású receptor Az antigén receptorhoz kötődése aktiválja


Autoan'testek vizsgáló módszerei, HLA 'pizálás. Immunológiai és Biotechnológiai Intézet PTE- ÁOK

Autoan'testek vizsgáló módszerei, HLA 'pizálás. Immunológiai és Biotechnológiai Intézet PTE- ÁOK Autoan'testek vizsgáló módszerei, HLA 'pizálás Immunológiai és Biotechnológiai Intézet PTE- ÁOK Természetes autoan'testek Pathológiás autoan'testek Természetes autoan'testek IgM Alacsony affinitás Alacsony


TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK


Őssejtek és hemopoiézis 1/23

Őssejtek és hemopoiézis 1/23 Őssejtek és hemopoiézis 1/23 Sejtsorsok Sejtosztódás Sejt differenciáció sejtvonulatok szövetek (több sejtvonulat) Sejt pusztulás Sejtvonulat az őssejtek és azok utódai egy adott szöveti sejt differenciációja


Zárójelentés. A) A cervix nyújthatóságának (rezisztencia) állatkísérletes meghatározása terhes és nem terhes patkányban.

Zárójelentés. A) A cervix nyújthatóságának (rezisztencia) állatkísérletes meghatározása terhes és nem terhes patkányban. Zárójelentés A kutatás fő célkitűzése a β 2 agonisták és altípus szelektív α 1 antagonisták hatásának vizsgálata a terhesség során a patkány cervix érésére összehasonlítva a corpusra gyakorolt hatásokkal.


A 2014/11. SZÁM TARTALMA. Sárközi R., Makrai L., Tóth A., Fodor L.: Pásztiné G. E., Gálfi P., Molnár Zs., Csavojetz A., Meggyesházi N.

A 2014/11. SZÁM TARTALMA. Sárközi R., Makrai L., Tóth A., Fodor L.: Pásztiné G. E., Gálfi P., Molnár Zs., Csavojetz A., Meggyesházi N. A 2014/11. SZÁM TARTALMA SERTÉS Sárközi R., Makrai L., Tóth A., Fodor L.: Hazai Actinobacillus pleuropneumoniae törzsek antibiotikum-érzékenysége Pásztiné G. E., Gálfi P., Molnár Zs., Csavojetz A., Meggyesházi


Kutatási beszámoló ( )

Kutatási beszámoló ( ) Kutatási beszámoló (2008-2012) A thrombocyták aktivációja alapvető jelentőségű a thrombotikus betegségek kialakulása szempontjából. A pályázat során ezen aktivációs folyamatok mechanizmusait vizsgáltuk.


Újabb ismeretek a Graves-ophthalmopathia kórisméjében

Újabb ismeretek a Graves-ophthalmopathia kórisméjében Újabb ismeretek a Graves-ophthalmopathia kórisméjében Dr. Molnár Ildikó 2004 Tézisek Az utóbbi 11 évben végzett tudományos munkám új eredményei 1. Graves-kórhoz társult infiltratív ophthalmopathia kialakulásában


LIQUORVIZSGÁLAT. A lumbálpunkció helye a klinikai neurodiagnosztikában. Tantermi előadás V.évf. 2014. szeptember 24. Bors László Neurológiai Klinika

LIQUORVIZSGÁLAT. A lumbálpunkció helye a klinikai neurodiagnosztikában. Tantermi előadás V.évf. 2014. szeptember 24. Bors László Neurológiai Klinika LIQUORVIZSGÁLAT A lumbálpunkció helye a klinikai neurodiagnosztikában Tantermi előadás V.évf. 2014. szeptember 24. Bors László Neurológiai Klinika Összefoglalás 1. A liquor termelődése, keringése, felszívódása


Immunológia I. 2. előadás. Kacskovics Imre (

Immunológia I. 2. előadás. Kacskovics Imre ( Immunológia I. 2. előadás Kacskovics Imre ( Az immunválasz kialakulása A veleszületett és az adaptív immunválasz összefonódása A veleszületett immunválasz mechanizmusai A veleszületett



SZEMÉLYRE SZABOTT ORVOSLÁS II. Az élettudományi-klinikai felsőoktatás gyakorlatorientált és hallgatóbarát korszerűsítése a vidéki képzőhelyek nemzetközi versenyképességének erősítésére TÁMOP-4.1.1.C-13/1/KONV-2014-0001 SZEMÉLYRE SZABOTT



VÁLASZ DR. JULOW JENİ TANÁR ÚR, AZ MTA DOKTORA OPPONENSI VÉLEMÉNYÉRE. Tisztelt Julow Jenı Tanár Úr! 1 VÁLASZ DR. JULOW JENİ TANÁR ÚR, AZ MTA DOKTORA OPPONENSI VÉLEMÉNYÉRE Tisztelt Julow Jenı Tanár Úr! Köszönöm Dr. Julow Jenı Tanár Úr részletes, minden szempontra kiterjedı opponensi véleményezését, megtisztelı,


Spondylitis ankylopoeticahoz társuló osteoporosis

Spondylitis ankylopoeticahoz társuló osteoporosis Spondylitis ankylopoeticahoz társuló osteoporosis Szántó Sándor DE OEC, Reumatológiai Tanszék 2013.11.05. Szeminárium Csontfelszivódás és csontképzés SPA-ban egészséges előrehaladott SPA Spondylitis ankylopoetica


Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 3. előadás Az immunrendszer molekuláris elemei: antigén, ellenanyag, Ig osztályok Az antigén meghatározása Detre László: antitest generátor - Régi meghatározás:


A pajzsmirigy. A pajzsmirigyhormonok

A pajzsmirigy. A pajzsmirigyhormonok A pajzsmirigy A pajzsmirigyhormonok a pajzsmirigy mintegy 20 g súlyú páros szerv tireociták follikulusok körül; pajzsmirigykolloid (tireoglobulin glikoprotein) tárolás a pajzsmirigy 2 aktív hormont termel:


4. A humorális immunválasz október 12.

4. A humorális immunválasz október 12. 4. A humorális immunválasz 2016. október 12. A klónszelekciós elmélet sarokpontjai: Monospecifictás: 1 sejt 1-féle specificitású receptor Az antigén receptorhoz kötődése aktiválja a limfocitát A keletkező


Alapfogalmak I. Elsősorban fehérjék és ezek szénhidrátokkal és lipidekkel alkotott molekulái lokalizációjának meghatározásának eszköze.

Alapfogalmak I. Elsősorban fehérjék és ezek szénhidrátokkal és lipidekkel alkotott molekulái lokalizációjának meghatározásának eszköze. Alapfogalmak I. Immunhisztokémia: Az immunhisztokémia módszerével szöveti antigének, vagy félantigének (haptének) detektálhatók in situ, specifikus antigén-antitest kötés alapján. Elsősorban fehérjék és


Túlérzékenységi reakciók Gell és Coombs felosztása szerint.

Túlérzékenységi reakciók Gell és Coombs felosztása szerint. Túlérzékenységi reakciók Gell és Coombs felosztása szerint. A felosztás mai szemmel nem a leglogikusabb, mert nem tesz különbséget az allergia, az autoimmunitás és a a transzplantációs immunreakciók között.


Tóth-Petrovics Ágnes: Szaporasági teljesítmények növelése exogén hormonális kezelések nélkül

Tóth-Petrovics Ágnes: Szaporasági teljesítmények növelése exogén hormonális kezelések nélkül Tóth-Petrovics Ágnes: Szaporasági teljesítmények növelése exogén hormonális kezelések nélkül Tejtermelő tehenek szaporításának nehézségei tenyésztői szemmel A tejtermelés világszerte szinte kizárólag holstein


Humán genom variációk single nucleotide polymorphism (SNP)

Humán genom variációk single nucleotide polymorphism (SNP) Humán genom variációk single nucleotide polymorphism (SNP) A genom ~ 97 %-a két különböző egyedben teljesen azonos ~ 1% különbség: SNP miatt ~2% különbség: kópiaszámbeli eltérés, deléciók miatt 11-12 millió


Szőlőmag extraktum hatása makrofág immunsejtek által indukált gyulladásos folyamatokra Radnai Balázs, Antus Csenge, Sümegi Balázs

Szőlőmag extraktum hatása makrofág immunsejtek által indukált gyulladásos folyamatokra Radnai Balázs, Antus Csenge, Sümegi Balázs Szőlőmag extraktum hatása makrofág immunsejtek által indukált gyulladásos folyamatokra Radnai Balázs, Antus Csenge, Sümegi Balázs Pécsi Tudományegytem Általános Orvostudományi Kar Biokémiai és Orvosi Kémiai


Plazmafehérjék és plazmaenzimek laboratóriumi diagnosztikája

Plazmafehérjék és plazmaenzimek laboratóriumi diagnosztikája Plazmafehérjék és plazmaenzimek laboratóriumi diagnosztikája Plazmafehérjék funkciója Funkció: transzport humorális immunitás enzimek proteáz inhibitorok a plazma onkotikus nyomásának fenntartói pufferelés


A metabolikus szindróma genetikai háttere. Kappelmayer János, Balogh István (

A metabolikus szindróma genetikai háttere. Kappelmayer János, Balogh István ( A metabolikus szindróma genetikai háttere Kappelmayer János, Balogh István ( Definíció WHO, 1999 EGIR, 1999 ATP III, 2001 Ha három vagy több komponens jelen van a betegben: Vérnyomás: > 135/85


Receptor Tyrosine-Kinases

Receptor Tyrosine-Kinases Receptor Tyrosine-Kinases MAPkinase pathway PI3Kinase Protein Kinase B pathway PI3K/PK-B pathway Phosphatidyl-inositol-bisphosphate...(PI(4,5)P 2...) Phosphatidyl-inositol-3-kinase (PI3K) Protein kinase


Klinikai kémia. Laboratóriumi diagnosztika. Szerkesztette: Szarka András. Írta: Budapesti Műszaki és Gazdaságtudományi Egyetem Semmelweis Egyetem

Klinikai kémia. Laboratóriumi diagnosztika. Szerkesztette: Szarka András. Írta: Budapesti Műszaki és Gazdaságtudományi Egyetem Semmelweis Egyetem Klinikai kémia Laboratóriumi diagnosztika Szerkesztette: Szarka András Írta: Szarka András (1-8, 11-15. fejezet) Keszler Gergely (9, 10. fejezet) Budapesti Műszaki és Gazdaságtudományi Egyetem Semmelweis


7. előadás: A plazma mebrán szerkezete és funkciója. Anyagtranszport a plazma membránon keresztül.

7. előadás: A plazma mebrán szerkezete és funkciója. Anyagtranszport a plazma membránon keresztül. 7. előadás: A plazma mebrán szerkezete és funkciója. Anyagtranszport a plazma membránon keresztül. A plazma membrán határolja el az élő sejteket a környezetüktől Szelektív permeabilitást mutat, így lehetővé


Új könnyűlánc diagnosztika. Dr. Németh Julianna Országos Gyógyintézeti Központ Immundiagnosztikai Osztály MLDT-MIT Továbbképzés 2006

Új könnyűlánc diagnosztika. Dr. Németh Julianna Országos Gyógyintézeti Központ Immundiagnosztikai Osztály MLDT-MIT Továbbképzés 2006 Új könnyűlánc diagnosztika Dr. Németh Julianna Országos Gyógyintézeti Központ Immundiagnosztikai Osztály MLDT-MIT Továbbképzés 2006 1845 Bence Jones Protein vizelet fehérje 1922 BJP I-II típus 1956 BJP


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


eljárásokkal Doktori tézisek Szatmári Tünde Semmelweis Egyetem Klinikai Orvostudományok Doktori Iskola Sugárterápia Program

eljárásokkal Doktori tézisek Szatmári Tünde Semmelweis Egyetem Klinikai Orvostudományok Doktori Iskola Sugárterápia Program Agydaganatok sugárterápia iránti érzékenységének növelése génterápiás eljárásokkal Doktori tézisek Szatmári Tünde Semmelweis Egyetem Klinikai Orvostudományok Doktori Iskola Sugárterápia Program Doktori


A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei

A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A TM vizsgálatok alapkérdései A vizsgálatok célja, információértéke? Az alkalmazás területei? Hogyan válasszuk ki az alkalmazott


Bioaktív peptidek technológiáinak fejlesztése

Bioaktív peptidek technológiáinak fejlesztése Bioaktív peptidek technológiáinak fejlesztése BIOAKTÍV PEPTIDEK A kolosztrum kitűnő fehérjeforrás, melyben az esszenciális aminosavak és más organikus nitrogén-forrásként szolgáló vegyületek rendkívül


OTKA nyilvántartási szám: K48376 Zárójelentés: 2008. A pályázat adott keretein belül az alábbi eredményeket értük el:

OTKA nyilvántartási szám: K48376 Zárójelentés: 2008. A pályázat adott keretein belül az alábbi eredményeket értük el: Szakmai beszámoló A pályázatban a hemodinamikai erők által aktivált normális és kóros vaszkuláris mechanizmusok feltárását illetve megismerését tűztük ki célul. Az emberi betegségek hátterében igen gyakran


Az immunológia alapjai

Az immunológia alapjai Az immunológia alapjai 8. előadás A gyulladásos reakció kialakulása: lokális és szisztémás gyulladás, leukocita migráció Berki Timea Lokális akut gyulladás kialakulása A veleszületeh és szerzeh immunitás


Daganat immunterápia molekuláris markereinek tanulmányozása biofizikai módszerekkel. Áramlási és képalkotó citometria

Daganat immunterápia molekuláris markereinek tanulmányozása biofizikai módszerekkel. Áramlási és képalkotó citometria Daganat immunterápia molekuláris markereinek tanulmányozása biofizikai módszerekkel. Áramlási és képalkotó citometria Szöllősi János, Vereb György Biofizikai és Sejtbiológiai Intézet Orvos- és Egészségtudományi


Forgácsolás technológia számítógépes tervezése I.

Forgácsolás technológia számítógépes tervezése I. Forgácsolás technológia számítógépes tervezése I. BAG-FS-15-NLK Fogazást követı és befejezı megmunkálások Dr. Mikó Balázs 1 Foggömbölyítés, fogsarkítás Célja: csúszókerekeknél a


A növény inváziójában szerepet játszó bakteriális gének

A növény inváziójában szerepet játszó bakteriális gének A növény inváziójában szerepet játszó bakteriális gének merisztéma korai szimbiotikus zóna késői szimbiotikus zóna öregedési zóna gyökér keresztmetszet NODULÁCIÓ növényi jel Rhizobium meliloti rhizobium



HUMAN IMMUNDEFICIENCIA VÍRUS (HIV) ÉS AIDS HUMAN IMMUNDEFICIENCIA VÍRUS (HIV) ÉS AIDS Dr. Mohamed Mahdi MD. MPH. Department of Infectology and Pediatric Immunology University of Debrecen (MHSC) 2012 Diagnózis HIV antitest teszt: A HIV ellen termel
