A termesztett szamóca gyümölcsfejl désében és érésében szerepet játszó gének izolálása

Méret: px
Mutatás kezdődik a ... oldaltól:

Download "A termesztett szamóca gyümölcsfejl désében és érésében szerepet játszó gének izolálása"

Átírás

1 1 A termesztett szamóca gyümölcsfejl désében és érésében szerepet játszó gének izolálása Doktori értekezés Balogh Andrea Gödöll 2006

2 2 A doktori iskola megnevezése: SZIE Növénytudományi Doktori Iskola tudományága: Növénytermesztési és Kertészeti Tudományok vezet je: Dr. Virányi Ferenc egyetemi tanár, az MTA doktora Szent István Egyetem Növényvédelemtani Tanszék doktori program: Növénynemesítés Genetikai és Biotechnológiai Módszerekkel programvezet : Dr. Heszky László egyetemi tanár, az MTA tagja Szent István Egyetem Genetika és Növénynemesítés Tanszék témavezet : Dr. Kiss Erzsébet egyetemi tanár, a mez gazdasági tudomány kandidátusa Szent István Egyetem Genetika és Növénynemesítés Tanszék Dr. Virányi Ferenc Dr. Kiss Erzsébet doktori iskola vezet je témavezet

3 3 Tartalomjegyzék TARTALOMJEGYZÉK RÖVIDÍTÉSEK JEGYZÉKE BEVEZETÉS ÉS CÉLKIT ZÉS 7 2. IRODALMI ÁTTEKINTÉS A szamóca Az etilén bioszintézis Az ACC-szintáz géncsalád Az ACC-oxidáz géncsalád Az etilén jelátviteli mechanizmus A gyümölcsök érése A szamóca érése, az etilén szerepe Gyümölcsfejl déssel és éréssel kapcsolatos génexpressziós és funkcionális vizsgálatok szamócában ANYAG ÉS MÓDSZER cdns-aflp Növényi anyag RNS izolálás, cdns szintézis cdns-aflp templát el állítása Adapter ligálás és pre amplifikáció nem szelektív primerekkel Szelektív amplifikáció 33 P izotóppal jelölt primerrel Az AFLP templát elkészítésekor használt pufferek összetétele Az AFLP sávok jellemzése Az expressziós mintázatok kvantitatív mérése és adatelemzés és 3 RACE reakciók A szamóca ACS, ACO és CTR1 részleges és teljes cdns-ek izolálása Genomi DNS izolálás Genomi klónok izolalása Promoterek izolálása Szemi-kvantitatív RT-PCR analízis Bioinformatikai elemzés Rizs protoplaszt izolálás és a FaRing-GFP, FaHd-GFP fúzió tranziens expressziója..29

4 4 Tartalomjegyzék A Rizs protoplaszt izolálás és a FaRing-GFP, FaHd-GFP fúzió tranziens expressziójához használt oldatok, táptalajok EREDMÉNYEK ÉS MEGVITATÁSUK A szamóca ACC-szintáz izolálása és expressziós mintázata A FaACS promoterének izolálása, bioinformatikai elemzése A szamóca ACC-oxidáz izolálása és expressziós mintázata A szamóca CTR1 izolálása és jellemzése A FaCTR1 promoter izolálása, bioinformatikai elemzése A gyümölcsérés során gátolt és indukált gének azonosítása cdns-aflp-vel Zöld gyümölcsben expresszálódó gének funkcionális csoportosítása Az érés során expresszálódó gének funkcionális csoportosítása Az aszmagban expresszálódó gének funkcionális csoportosítása Teljes hosszúságú cdns-ek izolálása és jellemzése Nitrilázszer fehérjét kódoló gén Ring finger fehérjét kódoló gén Két szamóca receptorszer kináz Az Arabidopsis SPATULA génnel homológ szamóca gén Plazma membrán ferhérjét (vízcsatornát) kódoló szamóca gén Homeodomén fehérjét kódoló szamóca gén Új tudományos eredmények KÖVETKEZTETÉSEK ÉS JAVASLATOK ÖSSZEFOGLALÁS 74 SUMMARY IRODALOMJEGYZÉK.78 KÖSZÖNETNYILVÁNÍTÁS 90

5 5 Rövidítések jegyzéke RÖVIDÍTÉSEK JEGYZÉKE ABA: abszcizinsav ABI1: (ABA Insensitive 1) ABA inszenzitív 1 ACC: 1-aminociklopropán-1-karboxil sav ACS: ACC-szintáz ACO: ACC-oxidáz AFLP: (Amplified Fragment Length Polymorphism) felszaporított hossz polimorfizmus ARF: (Auxin Response Factor) auxin-válasz faktor ATP: adenozin-trifoszfát AuxRE: (Auxin Responsive Element) auxin-válasz elem AVG: Aminoetoxi-Vinil-Glicin BLAST: Basic Local Alignment Search Tool bp: bázispár bhlh: (basic-helix-loop-helix) alap spirál-hurok-spirál BSA: (Bovine Serum Albumin) marha szérum albumin CaMV35S: karfiol mozaik vírus 35S promoter cdns: (copy) kópia DNS CNR: (Colorless Non-Ripening) pigmenthiányos érésmutáns CTR1: (Constitutive Triple Response) konstitutív hármas válasz 1-Cys Prx: 1-Cys peroxiredoxin DDB1: (UV-Damaged DNA Binding protein 1) UV-károsított DNS köt fehérje 1 DEPC: dietil-pirokarbonát DET1: (De-ETiolated 1) de-etiolált 1 dntp: dezoxiribonukleotid trifoszfát DTT: ditiotreitol E value: (expected value) várható érték EC: (Ethylene-CTR specific) etilén CTR-specifikus EIN: (Ethylene Insensitive) etilén inszenzitív EOL: (ETO1-Like) ETO1-szer ERD1: (early responsive to dehydration 1) dehidratáció korai válasz 1 gén ERE: (Ethylene Responsive Element) etilén-válasz elem EREBP: (ERE-Binding Protein) ERE-köt fehérje

6 6 Rövidítések jegyzéke ERF: (Ethylene Responsive transcription Factor) etilén válaszban résztvev transzkripciós faktor EST: (Expressed Sequence Tag) expresszált szekvencia EtBr: etídium bromid ETO: (EThylene-Overproducer) etilén túltermel ETR: (EThylene Response) etilén válasz GFP: (Green Fluorescent Protein): zöld fluoreszcens fehérje GUS: E. coli ß-D-glükuronidáz gén HDZip: homeodomén-leucin cippzár IAN: indol-3-acetonitril IES: indol-3-ecetsavmcp: 1-Metil-CikloPropén MES: 2-(N-morfolin) etánszulfonsav MTA: 5'-Metil-TioAdenozin NCBI: National Center for Biotechnology Information NOR: (NOn-Ripening) érésmutáns NOS: Nopalin szintáz nptii: Neomicin-foszfotranszferáz II ORF: (Open Reading Frame) nyitott olvasási keret PCR: (Polymerase Chain Reaction) polimeráz láncreakció PEG: polietilén glikol RACE: (Rapid Amplification of cdna ends) cdns végek gyors felszaporítása RAN1: (Responsive to ANtagonist) RIN: (Ripening Inhibitor) érés-gátló RLK: (Receptor-Like Kinase) receptorszer kináz TAIL-PCR: (Thermal Asymmetric InterLaced Polymerase Chain Reaction) termál aszimmetrikus összetett polimeráz láncreakció UTR: (UnTranslated Region) nem transzlálódó szakasz TDF: (Transcript Derived Fragment) transzkriptum eredet fragmentum U: (unit) egység

7 7 Irodalmi áttekintés 1. BEVEZETÉS ÉS CÉLKIT ZÉS A gyümölcsök érése, akár utóér, akár nem-utóér gyümölcsr l van szó, olyan általános jelenségeket foglal magába, mint a sejtfal szerkezetének megváltozása, az íz és aroma összetev k min ségi és mennyiségi módosulása, méret és színváltozás, ami mindenképpen jelent s génexpressziós változások eredménye. Ezek a változások lehet vé teszik - az eltér RNS profil alapján - az érésben szerepet játszó gének és promotereik meghatározását: a transzkriptumok azonosításával az érés indukálta gének felfedezését, illetve az átíródó gének promotereinek izolálását. Ezen a területen új korszakot nyitottak a genomprojektek. Az Arabidopsis thaliana, és a rizs teljes fizikai térképe alapján megkezd dhetett a magasabbrend növényekben m köd gének azonosítása és funkciójuk felderítése. Az etilén bioszintézisében és jelátviteli mechanizmusában szerepet jatszó gének izolálása. A klimaktérikus gyümölcsök érési mechanizmusa már jól ismert, és bizonyított tény, hogy a folyamatban az etilénnek kulcsfontossága van. Ezekben a növényekben (paradicsom, banán, alma) az etilén bioszintézisével és szignál transzdukciójával kapcsolatos géneket már azonosították, és többségüket funkcionálisan jellemezték. Ezzel ellentétben a nem klimaktérikus gyümölcsök esetében kevés adattal rendelkezünk az etilénnek a gyümölcsérésben betöltött szerepér l. Kutatásaink elkezdésekor a szamóca etilén bioszintézisében és jelátviteli mechanizmus kulcsgénei közül egyedül az ETR-t kódoló gén részleges szekvenciája volt ismert, ezért els dleges célunk volt az ACC-szintázt, ACCoxidázt és CTR1-et kódoló gének és promotereik azonosítása. A szamóca érését befolyásoló új gének izolálása, és az érés során különböz expressziós szintet mutató gének azonosítása. A szamóca gyümölcs érésében feltételezetten szerepet játszó gének azonosítása és ezáltal a nem utóér érés tanulmányozása céljából cdns-aflp módszert használtunk. A zöld, fehér, rózsaszín és piros érési stádiumban lev gyümölcsökben az aszmag és a gyümölcshús transzkriptum akkumulációjának elemzésével az expressziós mintázatok összehasonlítása volt a cél. Mivel szamócában kevés gén szekvenciainformációja publikus, kvantitatív cdns-aflp technikát alkalmaztunk, ami a gének expressziós mintázatának a nyomonkövetésével párhuzamosan, a ritka mrns-ek detektálását, a tanulmányozott folyamatokban (gyümölcsfejl dés, érés) résztvev új gének azonosítását is lehet vé teszi. A szövetspecifikus (gyümölcshúsban expresszálódó) gének azonosítása mellett, a

8 8 Irodalmi áttekintés gyümölcshúsban és aszmagban egyaránt jelen lev, expressziós mintázatukban hasonló gének azonosítását is célul t ztük ki a gyümölcshús és aszmag érésének közös szabályozási mechanizmusának és kölcsönhatásának feltárása végett. Teljes hosszúságú cdns-ek izolálása és jellemzése Az érés során akkumulálódó transzkriptumok közül az érésben betöltött feltételezhet funkciójuk alapján további jellemzésre olyanokat választottunk ki, amelyeket más gyümölcsök esetében már kapcsolatba hoztak az éréssel. A Ring finger gént, bhlh és HDzip transzkripciós faktorok, jelátviteli mechanizmusokban résztvev kulcsgének (kinázok), auxin bioszintézisben résztvev nitrilázszer gének teljes hosszúságú cdns-eit a cdns- AFLP fragmentumok szekvenciainformációjából kiindulva 5' és 3' RACE technikával izoláltuk. Elképzelhet, hogy a nitrilázszer fehérjét kódoló gén kivételével a többi gén funkcionális elemzése fényt deríthet a nem utóér érési folyamatoknak egy hormonális szint fölötti, szabályozási mechanizmusának feltárására.

9 9 Irodalmi áttekintés 2. IRODALMI ÁTTEKINTÉS 2.1. A szamóca A szamóca az egyik legkedveltebb és a legnagyobb mennyiségben termesztett bogyós gyümölcs a világon. Ével, gyöktörzses, t száras, indákkal szaporodó, lágyszárú növény. Levelei hármasan összetettek, a levélkék f részes szél ek. Fehér szirmú virágai t kocsányon, bogerny ben állnak. Elhúsosodó vacokkúpja piros szín, édes, leveses, és ennek felületén ülnek a száraz aszmagtermések. A szamóca gyümölcse aszmag-terméscsoport, amelynek részei a gyümölcskocsány, csészelevelek, a meghúsosodott vacok és az aszmagok. A különböz szín aszmagtermések a gyümölcs felületén, fajtára jellemz en eltér mélységben ülnek. A szamóca a Fragaria nemzetségbe, a Rosidae alosztályba és a rózsafélék (Rosaceae) családjába tartozik. A 19 leírt Fragaria faj 4 természetes ploidia csoportot alkot, a következ fontosabb képvisel kkel: a diploid F. vesca (2n = 2x = 14), a tetraploid F. orientalis (2n = 4x = 28), a hexaploid F. moschata (2n = 6x = 42) és az oktoploid F. virginiana és F. chiloensis (2n = 8x = 56). A kerti szamóca (Fragaria x ananassa Duch. = F. magna) az Észak- Amerikából származó F. virginiana és a Chiléb l származó F. chiloensis spontán keresztezõdésébõl a 18. század elején keletkezett Európában. Az új szamóca fajhibrid, amelyet Miller 1760-ban írt le, és amely a Fragaria x ananassa Duch. elnevezést kapta, a virginiai szamócától a piros gyümölcsszint, a keményebb húsállományt, a chilei szamócától pedig a gyümölcsnagyságot és a kiváló zamatot örökölte. Ez a fajhibrid lett az alapja a ma termesztett nagy gyümölcs szamócafajtáknak. Magyarországon shonos szamócafajok, a diploid erdei szamóca (Fragaria vesca L.) és a csattogó szamóca (Fragaria viridis Duch.) közül az el bbinek nemesítési és virológiai jelent sége van. Nemesítési szempontból könny csumázhatósága, kiváló zamata, egyes változatainak folytonterm (Fragaria vesca semperflorens Duch.), és indát nem képz jellege (Fragaria vesca efflagellis Duch.) értékes. A F. vesca virológiai jelent ségét vírusérzékenysége adja, így biotesztekben használható az egészséges anyanövények kiválasztásakor (Papp és Porpáczy 1999) Az etilén bioszintézis A magasabbrend növényekben az etilén bioszintézise metioninból indul (Yang és Hoffman, 1984): Metionin S-adenozil-metionin (AdoMet) ACC (1-aminociklopropán-1-

10 10 Irodalmi áttekintés karboxilát) C 2 H 4 (etilén). Növényekben az 1-aminociklopropán-1-karboxilát szintáz (ACS, EC ) az etilénbioszintézis kulcsenzime. 1. ábra. Az etilén bioszintézis útvonala és szabályozása (Wang et al. 2002). Az S-AdoMet szintézisét a SAM szintetáz katalizálja metioninból, egy ATP molekula / S- AdoMet felhasználásával. Az S-AdoMet nukleinsavak, fehérjék és lipidek metil donora. A S- AdoMet a poliaminok bioszintézisében is részt vesz (spermidin/ spermin bioszintetikus út). A Yang ciklusban (Yang és Hoffmann, 1984), az etilén bioszintézis els lépése az S-AdoMet konverziója 1-amino-ciklopropán-1-karboxil savvá (ACC), amelyet a piridoxál 5'-foszfát függ enzim katalizál. Az ACC mellett 5'-metiltioadenozin (MTA) is szintetizálódik az ACCszintáz segítségével, amely új metionin molekulák kialakulásához vezet, lezárva a Yang ciklust. Ez a folyamat teszi lehet vé az állandó celluláris metionin koncentráció fenntartását és metil-tio csoportok meg rzését, így a folyamatos etilén bioszintézis nagyobb metionin mennyiség igénybevétele nélkül zajlik le. Végül egy oxigénfügg folyamatban az ACC-t az ACC-oxidáz etilénné, szén-dioxiddá és cianiddá alakítja. A cianid -cianoalaninná alakul a - cianoalanin szintáz segítségével, megel zve a cianid toxicitását intenziv etilén szintéziskor (1.

11 11 Irodalmi áttekintés ábra). Az ACC szintáz és ACC oxidáz transzkripciós szabályozása szaggatott nyilakkal van jelölve az 1. ábrán. Feltételezhet, hogy az ACC szintázt ismeretlen foszfatázok (Ptase) és kinázok reverzibilisen foszforilálják. A kinázokat valószín leg különböz stresszfaktorok indukálják. Az ACC szintáz mindkét formája (natív és foszforilált (ACC szintáz-pi)) m köd képes, bár in vivo a natív ACC szintáz valószín leg kevésbé stabil vagy aktív. A fehérje C-terminális végéhez egy feltételezett inhibitor társulhat, ami leválik az enzimr l, ha ez foszforilálódik. Az etilén bioszintézisnek mind feed-back mind feed-forward szabályozását leírták különböz növényfajokban (Kende 1993, Nakatsuka et al. 1998, Barry et al. 2000). Ebben a szabályozási mechanizmusban a célfehérjék valószín leg az ACS különböz izoformái. Így például az etilén pozitívan szabályozza a paradicsom Le-ACS2 és Le-ACS4-et, és negatívan hat az Le-ACS6-ra (Nakatsuka et al. 1998) Az ACC-szintáz géncsalád Az ACC szintázt multigén család kódolja. Az Arabidopsis genomban 13 ACC szintáz gént (ACS1-13) azonosítottak, ezekb l az ACS3 valoszín leg pszeudogén, míg az ACS1 nem funkcionális fehérjét kódol (Liang et al. 1992; Liang et al. 1995). Az Arabidospsis-hoz hasonlóan az ACC-szintáz enzimet más növényfajokban is egy többtagú géncsalád kódolja, amelyek közül már azonosították például a cukkini (Huang et al. 1991), a paradicsom (Rottman et al. 1991), a mungó bab (Botella et al. 1993), a rizs (Zarembinski és Theologis 1993), szegf (Henskens et al. 1994), az alma (Lay-Yee et al. 1995; Rosenfield et al. 1996), a burgonya (Destefano-Beltran et al. 1995), a rózsa (Wang et al. 2004) megfelel klónjait. Arabidopsis-ban az ACS3 kivételével átíródnak, és a növény fejl dése során differenciáltan expresszálódnak. Bizonyították, hogy az ACS izoenzimek biokémiailag különböznek, alkalmazkodva az egyedi sejtkörnyezethez, így lehetséges, hogy az etilén mint szignálmolekula szövet- vagy sejtspecifitással rendelkezik (Yamagami et al. 2003). Arabidopsis-ban 7 ACS gén expressziós mintázatát tanulmányozták. Az ACS2-t cikloheximid, sebzés és 2 órányi etilén kezelés indukálja. Az etilén indukálta expresszió fokozatosan csökken, a továbbtartó etilén kezeléssel, az ACS2 feed-back szabályozására utalva (Van der Straeten et al. 1992; Liang et al. 1996). Csíranövényekben az ACS4 cikloheximiddel, indolecetsavval és sebzéssel indukálható (Liang et al. 1992; Abel et al. 1995). Az ACS5 lítium kloriddal és kis koncentrációjú citokininnel indukálható etiolált csíranövényekben (Vogel et al. 1998). Az ACS6 specifikusan indukálható cianiddal, fényben nevelt levelekben ózonnal, érintés okozta mechanikai stresszel; indukálható továbbá cikloheximiddel, indolecetsavval és etilénnel (Vahala et al. 1998, Overmyer et al. 2000, Smith és Arteca 2000). Az ACS10 a

12 12 Irodalmi áttekintés CONSTANS korai célgénje, ami Arabidopsis-ban fény hatására a virágzást idézi el (Samach et al. 2000) Az ACC-oxidáz géncsalád Az etilén bioszintézis utolsó lépését, az ACC etilénné történ alakítását az ACC oxidáz (ACO) enzim katalizálja. Az ACC oxidáznak fontos szerepe lehet az etilén bioszintézis szabályozásában különösképpen az etiléntermelést serkent körülmények közt (Holdsworth et al. 1988). Az ACC oxidázt szintén multigén család kódolja, különböz tagjait már számos növényfajban azonosították. Paradicsomból négy ACO gént (Le-ACO1-4) izoláltak, amelyek sebzés, virágfejl dés, levél és virágszeneszcencia és gyümölcsérés során indukálódnak (Nakatsuka et al. 1998). Arabidopsis-ban az ACO-t szintén multigén család kódolja, de kevés információval rendelkezünk az egyes génekkel kapcsolatban (Raz és Ecker 1999). Bár az etilén bioszintézis kulcsfontosságú szabályozó eleme az ACC szintáz, az ACO géncsalád tagjai szintén differenciáltan vannak szabályozva, bizonyítva funkcionális fontosságukat (Prescott és John 1996). Legalább két Arabidopsis ACO gén indukálható etilénnel (Zhong és Burns 2003). Az egyik ezek közül, ACO2, f leg a csíranövények apikális részén expresszálódik, ami a sejtek differenciált expanziójához és ennek következtében az apikális kampó kialakulásához vezet (Raz és Ecker 1999). Az etilénnel összhangban a gibberellineknek is szerepük van a folyamat szabályozásában (Vriezen et al. 2004). Ez a fajta több hormonos szabályozás az etilén bioszintézisnek közös vonása, ugyanis jelen van az auxin és etilén kölcsönhatásban is meghatározva két rizs ACO gén m ködését: az etilén indukálja az OsACO3-at de csak auxin hiányában, míg az OsACO2-t etilén jelenlétében kis mértében az auxin indukálja (Chae et al. 2000). Szamócában két (FaACO1 és FaACO2), érés során expresszálódó ACO génr l számoltak be, mindkét génr l bizonyították, hogy etilén hatására indukálódik, a FaACO2 expresszióját az auxin gátolja, míg a FaACO1-et mérsékelten indukálja (Trainotti et al. 2005). 2.3 Az etilén jelátviteli mechanizmus Az etilén szignál transzdukciós útvonal több komponensét csíranövények, etilén hatására sötétben, a "hármas-válasz"-nak elnevezett fenotípusos elváltozása alapján azonosították. Talajban, a magvak csírázása etiléntermeléssel párosul, ami a csíranövények úgynevezett "hármas-válasz"-át váltja ki. A hármas-válasz a túlzott apikális huroknak nevezett, átmeneti (tranziens) fej dési struktúrának kialakulását, valamint a hipokotil és

13 13 Irodalmi áttekintés gyökér megvastagodását jelenti (Abeles et al. 1992). A hármas-válasz a hajtás és a gyökér apikális merisztémáit óvja a talajon keresztüli növekedés során. 2. ábra. Az etilén jelátviteli út modellje. Az etilén receptor egy réz iont köt meg valószín leg a Golgi készülékben történ fehérje módosulás során. A réz iont a RAN1 szállító fehérje továbbítja. Az etilén receptor feltehet en az endoplazmatikus retikulum membránban található. Az EIN2 lokalizációja és a m ködését befolyásoló szignálok még nincsenek tisztázva. Az EIN3 a sejtmagban m ködik, de nem ismert, hogy etilén hiányában is nukleáris lokalizációjú vagy sem. Etilén hiányában az etilén receptor és a CTR1 aktívak és feltételezhet, hogy gátolják az EIN2-t. Amikor az etilén receptor felismeri az etilént, kikapcsol, és az EIN2 aktiválja az EIN3-at. Az aktivált EIN3 az ERF1 gén expresszióját, az ERF1 transzkripciós faktor pedig az etilénválaszban szerepet játszó géneket indukálja (Hirayama és Ugajin 2003) A hármas válasz etilén-etilén receptor kölcsönhatás révén következik be. Az ETR1 hisztidin kináz doménje kölcsönhatásba lép a CTR1-el, az etilén jelátvitel következ elemével. A CTR1 Raf-szer szerin/treonin kináz, (MAPKK kináz) és az etilén válasz negatív regulátora, ugyanis a ctr1 mutáns etilén hiányában konstitutív etilén válaszban nyilvánul meg (Kieber et al. 1993). Az etilén jelátviteli út tehát a következ képpen m ködik: etilén hiányában az etilénreceptorok aktiválják a CTR1-et, gátolva az etilén-válaszreakciókat. Etilén jelenlétében a receptorok nem aktiválják a CTR1-et, felszabadítva az etilén választ a CTR1

14 14 Irodalmi áttekintés által közvetített gátlás alól, aminek eredménye az EIN2 aktiválása (2. ábra) (Hua és Meyerowitz 1998; Hirayama és Ugajin 2003). Az EIN2 aktiválásának következményeképpen egy transzkripciós kaszkád indul be, amiben részt vesznek az EIN3/EIL és ERF transzkripciós faktorok (2. ábra) indukálva az etilén válaszban szerepet játszó géneket. Az Arabidopsis-ban 5 etilén receptort kódoló gént azonosítottak: ETR1, ERS1, ETR2, ERS2 és EIN4 (Hua és Meyerowitz 1998). Funkcionális ETR1 homológokat izoláltak többek között rózsából (Müller et al. 2000), búzából (Ma és Wang 2003), körtéb l (El-Sharkawy et al. 2003). A növény fejl dése során az etilén receptor gének szabályozása differenciált Arabidopsis-ban és paradicsomban (Hua és Meyerowitz 1998; Lashbrook et al. 1998). Az At-ERS1 (Hua és Meyerowitz 1998) és az NR (never ripe) (Wilkinson et al. 1995a) az etilén érzékelés autoregulációjában játszik szerepet, és expressziójuk indukálódik a hormon hatására. Szamócában három etilén receptorról van irodalmi adat (FaEtr1, FaErs1 és FaEtr2). Ezek közül a FaEtr1 és FaErs1 expressziója az érés során indukálódik, a FaEtr2 a fehér gyümölcsben mutatja a legnagyobb expressziós szintet, majd enyhén csökken tendenciát mutat (Trainotti et al. 2005). A CTR1 esetében Arabidopsis-ban eddig csak egy CTR1 funkciójú génr l számoltak be, ennek expressziós mintázata konstitutív. Elképzelhet hogy a CTR-t is multigéncsalád kódolja, paradicsomban már 4 CTR gént azonosítottak (Le-CTR1-Le-CTR4) valamint ezek differenciált szabályozását. Érdekes adat, hogy az etilén válasz negatív szabályozó elemeként, az Le-CTR1 pozitív etilén választ ad, ami az etilén érzékenység modulálására szolgálhat a megfelel etilénválasz létrejöttéhez a különböz környezeti hatások és szövettípusok esetében (Adams-Phillips et al. 2004) A gyümölcsök érése A gyümölcsök érése a fejl dés végs stádiuma, amikor is a beérett magvak kiszabadulnak. Az Arabidopsis bec je esetében ezt a folyamatot az érett term levelek szeneszcenciáját követ en ezek szétválása segíti el. Az Arabidopsis-al ellentétben, a húsos gyümölcsök, például a paradicsom, az érési folyamat során olyan biokémiai, fiziológiai és szerkezeti változásokon mennek keresztül, amelyek a magterjeszt szervezetek vonzását célozzák. Bár az érést eredményez jellegzetes biokémiai folyamatok a fajok között eltér ek, a tipikus változások magukba foglalják (1) a szín változását karotinoid és / vagy flavonoid akkumuláción keresztül, (2) a sejt turgor módosulását és a sejtfal szerkezetének változását (3) cukrok, savak és illóanyagok összetételének változását, amely befolyásolja a gyümölcs min ségét, ízét és aromáját, és (4) a sejtfal integritásának elvesztése következtében fokozott

15 15 Irodalmi áttekintés érzékenység lép fel opportunista patogénekkel szemben (Giovannoni 2004). Annak ellenére, hogy a klasszikus növényélettan a gyümölcsfajokat két csoportra osztja a fokozott respiráció és etiléntermelés jelenléte (klimaktérikus) vagy hiánya (nem klimaktérikus) alapján (Lelievre et al. 1997), a fentiekben felsorolt fejl désbeli változások mindkét csoport tagjaira jellemz ek (Giovannoni 2004). Érésükhöz etilént igényl klimaktérikus gyümölcsök körébe tartozik például a paradicsom, alma, banán és a legtöbb csonthéjas, míg a nem klimaktérikus csoportba sorolt sz l, ananász, citrom, narancs és szamóca érése fokozott etilén bioszintézis nélkül is bekövetkezik. Bár a két csoportot az irodalom élesen elkülöníti egymástól, egyre több publikáció számol be az etilén hatásáról nem klimaktérikus gyümölcsök érésében is (Goldschmidt et al. 1993, Alonso et al. 1995, El-Kereamy et al. 2003, Tesniere et al. 2004, Balogh et al. 2005b). Másrészt egyre több kutatási eredmény támasztja alá a nem hormonális tényez k szerepét klimaktérikus és nem klimaktérikus érés szabályozásában egyaránt. A nemutóér sz l ben például a VvAdh2 transzkripciója 1-MCP-vel gátolható és az etiléngeneráló vegyülettel, a 2-klór-etil-foszfonsavval stimulálható (Verries et al. 2004). Ugyancsak sz l ben exogén etilénnel stimulálható az antocianin bioszintézissel kapcsolatos gének expressziója (El-Kereamy et al. 2003). Chervin és munkatársai (2004) arról számolnak be, hogy a sz l érésekor átmeneti etilén termelés észlelhet. Ebben a stádiumban az etilén jelenléte szükséges a bogyó növekedéséhez, a savasság csökkenéséhez és az antocianin akkumulációjához. In silico génexpressziós vizsgálatban klimaktérikus és nem klimaktérikus érésre jellemz génexpressziót hasonlítottak össze érett sz l és paradicsom EST adtabázisok segítségével. A mindkét fajban jelenlev homológ gének között három transzkripciós faktort is találtak, ezek a MADS-box, RING cink ujj és bzip transzkripciós faktorok családjába tartoznak (Fei et al. 2004). Ugyanez a tanulmány 18 érés indukálta és 14 érés gátolta transzkripciós faktorról számol be paradicsomban, bár ezeknek az érés szabályozásával való funkcionális kapcsolata továbbra is ismeretlen. Paradicsomban, érésmutánsok tanulmányozásával több transzkripciós faktor érés szabályozási szerepére mutatták rá. Érdekes a rin, a nor (non-ripening) és Cnr (Colorless nonripening) paradicsom spontán érésmutáns, ugyanis az érés etilén szint feletti szabályozásával kapcsolatos (Adams-Philips et al. 2004). A rin vagy nor homozigóta valamint a domináns Cnr allélt hordozó gyümölcsök kifejl dnek és magot termelnek, de a gyümölcsök nem érnek be. A kifejl dött és be nem érett rin, nor és Cnr gyümölcsben nincs klimaktérikus légzés sem megnövekedett etilén bioszintézis. Az etilénkezelés nem állítja vissza a rin, nor vagy Cnr gyümölcsök érését, de indukálja az etilén-függ géneket (3. ábra). Ez a megfigyelés azt

16 16 Irodalmi áttekintés támasztja alá, hogy a rin, nor és Cnr nagyobb befolyással rendelkezik a klimaktérikus érésszabályozásban, mint az etilén és az ilyen mechanizmusokról elképzelhet, hogy a klimaktérikus és a nem klimaktérikus gyümölcsökben egyaránt jelen vannak (Giovannoni 2004). A rin és nor molekuláris jellemzéséb l kiderült, hogy a rin-t egy MADS-box transzkripciós faktor (LeMADS-RIN) utolsó exonjának deléciója okozza (Vrebalov et al. 2002). A nor lokuszon szintén egy transzkripciós faktort azonosítottak, bár ez nem tartozik a MADS-box gének családjába (Adams-Philips et al. 2004). Az LeMADS-RIN homológját szamócából is izolálták (Fv-MADS-9), amely gyümölcs specifikus expressziót mutat és filogenetikailag az LeMADS-RIN-nel tartozik egy csoportba (Vrebalov et al. 2002). Ez a transzkripciós faktor a jelátviteli útban az etilén fölött helyezkedik el, és valószín leg a klimaktérikus és nem klimaktérikus érés szabályozásának közös láncszeme lehet (Vrebalov et al. 2002, Adams-Philips et al. 2004) (3. ábra).. 3. ábra. A klimaktérikus érést szabályozó molekuláris mechanizmus modellje. Az LeMADS- RIN, LeNOR, valószín leg további MADS-box fehérjék, CNR és még nem azonosított tényez k (?) képviselik azt a fejl désbeli jelátviteli rendszert, amely a klimaktérikus gyümölcsökben elindítja az érést. A LeMADS-RIN-el homológok, nem klimaktérikus fajokra is vonatkozhatnak. Ez a fejl désbeli jelátviteli rendszer szabályozza az etilén szintézist a nem etilén-közvetítette érési válaszok mellett (piros szaggatott nyíllal jelölve). A fény befolyásolja az érést, a paradicsomban, a karotinoid akkumuláció kapcsolatban, és a DET1 (hp2) és DDB1 (hp1) géntermékek aktivitásán keresztül (Adams-Philips et al. 2004). Az etilénnel ellentétben, ami a klimaktérikus gyümölcsöknél a legtöbb érési folyamat befejezéséhez szükséges, a fény hatása az érésre a pigment akkumuláció szabályozásában

17 17 Irodalmi áttekintés nyilvánul meg (Adams-Philips et al. 2004). A karotinodok és flavonoidok a foto-oxidációt semlegesít antioxidáns tulajdonsággal rendelkeznek, de nutritív jelent ségük is van (Hwang és Bowen, 2002). A paradicsom pigmentmutánsokra (hp1, hp2), a fokozott fényérzékenység következtében, a nagymérték karotinoid és flavonoid akkumuláció jellemz. Mindkét gént klónozták, és az Arabidopsis-ban már leírt fény jelátviteli út komponensei. A hp1 a DDB1-el (UV-Damaged DNA binding protein 1), a hp2 a DET1-el (De-Etiolated) génekkel homológ paradicsom gének mutációjának eredménye (Mustilli et al. 1999, Liu et al. 2004) A szamóca érése, az etilén szerepe A szamóca gyümölcs növekedését leginkább az aszmagból a gyümölcshúsba áramló auxin befolyásolja (Nitsch 1950). A gyümölcsfej dés kés bbi szakaszában (középs zöld stádium), az érés el tt, a gyümölcshús auxin szintje csökken, valószín leg az aszmagból áramló auxinmennyiség csökkenése majd megsz nése miatt, ami el idézi az érést (Given et al. 1988). Az érés kezdetekor olyan gének indukálódnak, amelyek felel sek a pigmentációban és szerkezeti tulajdonságokban bekövetkezett drámai változásokért (Manning 1994, 1998). Klimaktérikus gyümölcsökben az érést beindító jelmolekula az etilén, de nem minden érési folyamat etilén-függ (Lelièvre et al. 1997). A érése során, az érés utolsó fázisában, a szamóca enyhén emelked etiléntermelést mutat (Perkins-Veazie et al. 1996). Az ACCoxidázt és etilén receptorokat kódoló gének izolálásáról és expressziós mintázatukról megjelent friss irodalmi adatok összhangban vannak a Perkins-Veazie által leírt eredményekkel, ugyanis az érés során indukálódó FaACO1 és FaACO2 az etiléntermelés fokozódását jelenti (Trainotti et al. 2005). Releváns adat, hogy a megnövekedett etilénszintézissel párhuzamosan az etilén receptorok szintézise is fokozódott. Ezeknek a receptoroknak a többsége a degenerált hisztidin-kináz doménnel rendelkez etilén receptorok csoportjába tartozik, amelyek a CTR1-el (etilén válasz negatív regulatorával) gyengebb kapcsolatot hoznak létre, így a szamóca alacsony etiléntermelése elégend lehet az érési folyamtok beindításához (Trainotti et al. 2005). Az etilén szerepének tisztázása és esetleges gyakorlati haszon érdekében (a szamóca eltarthatóság idejének hosszabbítása) több kutatócsoport foglalkozott az 1-MCP szamóca gyümölcsérésre kifejtett hatásával. Az 1-MCP (1-metilciklopropén) standard szobah mérsékleten és nyomáson az gázhalmazállaptú. Hatásmechanizmusának alapja, hogy köt dik az etilén receptorokhoz és gátolja a jelátviteli folyamatokat (Sisler et al. 1996; Sisler és Serek 1997). Az 1-MCP az etilénnél tízszer nagyobb affinitással köt dik a receptorokhoz. Az etilénnel ellentétben, az 1-MCP hatása sokkal kisebb koncentrációnal jelentkezik. Az 1-

18 18 Irodalmi áttekintés MCP néhány növényfaj esetében feed back gátlás révén az etilén bioszintézist is befolyásolja (Blankenship és Dole 2003). Már nagyon kis koncentrációnál (2,5 nl/l 1 l/l) hatékony (Sisler et al. 1996) és ebben a koncentrációtartományban nem mérgez, ugyanakkor a növényi szövetb l gyorsan diffundál, almánál, a kezelést követ en nyolc óra után már nem volt detektálható a gyümölcshúsban (Blankenship és Dole 2003). Tulajdonságai miatt az 1-MCP gyakorlati alkalmazása elterjedt, számos gyümölcs, zöldség és vágottvirág esetében gátolja az etilén hatását, növelve a gyümölcsök eltarhatóságát valamint a vágottvirágok vázaélettartamát. Alapkutatásban az etilén szerepének tisztázása céljából alkalmazzák. Szamócában az 1-MCP hatását eddig az 'Everest', 'Tioga', 'Seascape' és 'Pajaro' fajták esetében vizsgálták (Ku és Willis 1999, Tian et al. 2000, Jiang et al. 2001). Az 1-MCP hatása függött az alkalmazott koncentrációtól, valamint az utólagos tárolási h mérséklett l. Ezekszerint 5-15 nl/l koncentrációban a kezelés hatására a gyümölcsök eltarthatósága 20ºC-on 35%-al, 5ºC-on pedig 150%-al n tt. Nagyobb koncentrációnál (500 nl/l) mind 20ºC-on mind 5ºC-on is 30-60%-al csökkent az eltarthatóság (Ku és Willis 1999). Jiang et al. (2001) kísérletében magas 1-MCP ( nl/l) koncentráció szintén negatívan befolyásolta a szamóca gyümölcsök eltarthatóságát ami f leg a patogénekkel szembeni nagyobb fogékonyság következménye. Nagy koncentracióban ugyanis az 1-MCP gátolta a fenilalanin ammónia-liáz aktivitását valamint csökkentette a gyümölcsök antocianin és fenol tartalmát. Ismert a növényi fenolok patogénekkel szembeni aktivitása, a csökkentett fenoltartalom tehát felel s lehet a kisebb rezisztenciáért. Ugyanakkor kisebb ( nl/l) alkalmazott koncentráció esetében az 1-MCP csökkentette az etilén termelést és a gyümölcsök puhulását, javítva az eltarthatóságukat Gyümölcsfejl déssel és éréssel kapcsolatos génexpressziós és funkcionális vizsgálatok szamócában Az utóbbi években több kutatócsoport is beszámolt a szamóca érésében szerepet játszó gének azonosításáról, klónozásáról. A kutatások els dleges célpontját a sejtfal metabolizmusával kapcsolatos gének jelentették, ugyanis a gyümölcs puhulása, f leg a szamóca esetében, fontos min ségi bélyeg tároláskor (1. táblázat). A legtöbb esetben az azonosított gének többségét a gyümölcshúsból izolálták, és csak néhány hozható kapcsolatba az aszmag fejl désével. Génazonosításra alkalmazott stratégiák: degenerált oligonukleotidokkal végzett RT-PCR (Kim és Chung 1998, Llop-Tous et al. 1999, Harrison et al. 2001, Trainotti et al. 2001) valamint klónkeresés cdns könyvtárakban (Harpster et al. 1998, Nam et al. 1999, Civello et al. 1999). Gyümölcséréssel kapcsolatos gének izolálására és

19 19 Irodalmi áttekintés génexpressziós mintázatok elemzése céljából használták a fehérje két-dimenziós poliakrilamid gél-elektroforézist (Manning 1994, 1998), és a differential-display technikát (Wilkinson et al. 1995b) is. Az 1. táblázatban feltüntetett gének többségét gyümölcshúsból izolálták, de nemrég elkészült egy teljes növényt átfogó, 1304 szekvenciát tartalmazó EST gy jtemény is (Folta et al. 2005). 1. táblázat. Szamócában azonosított és funkcionálisan jellemzett gének Azonosított gén Funkció Szerz k Pektát liázt kódoló Medina-Escobar et al. (1997), Sejtfalbontás gén Benitez-Burraco et al. (2003) FaExp2 Sejtfalbontás Civello et al. (1999) SAAT Gyümölcsaroma kialakulása Aharoni et al. (2000), Beekwilder et al. (2004) Fa gal Sejtfalbontás Trainotti et al. (2001) FaMYB1 Antocianinok és flavonolok bioszintézisének szabályozása Aharoni et al. (2001) GalUR C-vitamin bioszintézis Agius et al. (2003) STAG1 MADS box gén, AGAMOUS homológ Rosin et al. (2003) Fahyprp Polifenol horgonyzás Blanco-Portales et al. (2004) FaXyl1 Sejtfalbontás Martinez et al. (2004) FaPE1 - FaPE4 Sejtfalbontás Castillejo et al. (2004) Fitocisztatint kódoló gén Kórokozókkal szembeni védekezés Martinez et al. (2005) FaGT2 Cinnamoil glükóz bioszintézise Lunkenbein et al. (2006) Rövidítések: FaExp2: expanzin2 gén, SAAT: alkohol aciltranszferáz gén, Fa gal: ß- Galaktozidáz gén, FaMYB1: MYB transzkripciós faktorok csoportjába tartozó gén, GalUR: D-galakturonsav reduktáz gén, Fahyprp: hidroxyprolinban gazdag protein gén, FaXyl1: betaxylozidáz gén, FaPE1 - FaPE4: pektin észterázt kódoló gén, FaGT2: glükoziltranszferáz gén Az érés és különböz tényez k hatására módosuló génexpressziós mintázatok vizsgálatában jelent s áttörést értek el a microarray technika alkalmazásával (Aharoni és O Connell 2002; Aharoni et al. 2002; Alba et al. 2004). Számos, az érés során expresszálódó új szamóca gént azonosítottak, több tucat auxin-függ és független, valamint az éréskor az oxidatív stressz hatására indukálódó génr l számoltak be (Aharoni et al. 2002). Az érés indukálta gének funkcionális vizsgálata során FaMYB1 transzkripciós faktorról a fehérje dohányban történt túltermeltetésével sikerült bizonyítani, hogy az antocianin és flavonolok bioszintézisének szabályozásában kulcsszerepet tölt be (Aharoni et al. 2001). Hasonló stratégiával bizonyították és jellemezték az alkohol aciltranszferázt kódoló SAAT gén funkcióját, amely a szamóca gyümölcsaromájának kialakulásáért felel s (Beekwilder et al. 2004).

20 20 Anyag és módszer 3. ANYAG ÉS MÓDSZER 3.1. cdns-aflp Növényi anyag A cdns-aflp-ben használt szamóca gyümölcs (Fragaria x ananassa Duch. cv. Elsanta ) egy genti (Belgium) kertészetb l származik. Zöld, fehér, rózsaszín és piros érési stádiumban lev gyümölcsöket gy jtöttünk be (4. ábra). Az RT-PCR-hez, DNS izoláláshoz használt növényi anyagot a SZIE kertészeti tanszéke biztosította, a Botrytis cinerea-val fert zött gyümölcsök is innen származnak. 4. ábra. A cdns-aflp-ben használt zöld, fehér, rózsaszín és piros érési stádiumban lev szamóca gyümölcs RNS izolálás, cdns szintézis Az aszmagból és gyümölcshúsból az összes RNS kivonást a Salzman et al. (1999) által közölt módszerrel végeztük. A vegetatív növényi részekb l az RNS izolálás a Qiagen cég RNeasy kit-jével történt. A reverz transzkripciót, cdns szintézist valamint a cdns-aflp analízist Breyne et al. (2003) átal közölt módszer alapján végeztük (5. ábra). A reverz transzkripcióhoz, illetve cdns szintézishez 10 g össz RNS-t használtunk, biotinjelölt oligo-dt 25 primer (Genset) és SuperScript II (Life Technologies) alkalmazásával. A cdns szintézis reakcióelegye: 20 l totál RNS, 1 l oligo-dt25-bio (700 ng/ l), 4 l H 2 O (DEPC-kezelt), 8 l 5 x First Strand puffer, 4 l 0,1 M DTT, 2 l 10 mm dntp, 1 l Superscript II (200 U/ l). A reakcióelegyet két órán keresztül 42 C-on inkubáltuk. A második szál szintézisekor használt reakcióelegy összetétele: 40 l els szál reakcióelegy, 16 l 10 x E. coli DNS ligáz puffer, 3 l 10 mm dntp, 6 l 0,1 M DTT, 1,5 l E. coli DNS ligáz (10 U/ l), 5 l E. coli DNS polimeráz I (10 U/ l), 1,6 l RNáz H (1 U/ l), H 2 O 160 l végtérfogatig. A reakcióelegyet egy órán keresztül

21 21 Anyag és módszer 12 C-on, majd egy órán keresztül 22 C-on inkubáltuk. A cdns-t a QIAquick spin oszloppal (Qiagen) tisztítottuk cdns-aflp templát el állítása A kett sszálú cdns restrikciós emésztéséhez a BstYI és MseI restrikciós enzimeket (New England Biolabs) használtuk. Az emésztést két lépésben hajtottuk végre. Az els emésztési elegy összetétele: 20 μl cdns, 10 U BstYI, 4 μl 10 x RL puffer, H 2 O 40 μl végtérfogatig. Az elegyet 60 C-on inkubáltuk két órán keresztül. 5. ábra. A cdns-aflp technika elve (Breyne et al. 2003). A BstYI enzimmel történt emésztés után a 3 biotinjelölt fragmentumokat streptavidinnel burkolt gyöngyökre (Dynal) rögzítettük, majd a nem rögzített fragmentumokat mosással eltávolítottuk. Mintánként 10 μl gyöngyöt mostunk 100 μl 2 x STEX pufferben majd 40 μl 2 x STEX pufferben szuszpendáltuk újra és hozzáadtuk a 40 μl emésztett cdns-hez. Az elegyet szobah n 30 percig inkubáltuk enyhe rázatás mellett (1000 rpm). Ezt követ en a gyöngyöket mágnessel rögzítettük és 100 μl 1 x STEX pufferrel mostuk, majd új cs be pipettáztuk át, és négyszer mostuk 100 μl 1 x STEX pufferrel. Mosás után a gyöngyöket 30 μl T 10 E 0.1 -ben szuszpendáltuk fel. A streptavidin gyöngyökre rögzített cdns fragmentumokat másodszorra

22 22 Anyag és módszer MseI enzimmel emésztettük. Az emésztési elegy összetétele: 30 μl gyöngy-szuszpenzió, 10 U MseI, 4 μl 10 x RL puffer, H 2 O 40 μl végtérfogatig. Az emésztést 2 órán keresztül 37 C-on végeztük enyhe rázatás mellett (1000 rpm). Az MseI-gyel való második emésztés után a gyöngyökr l felszabadult fragmentumokat használtuk templátként a további AFLP reakciókban (5. ábra) Adapter ligálás és pre-amplifikáció nem szelektív primerekkel A következ adaptereket használtuk: BstYI-F: 5 -CTCGTAGACTGCGTAGT-3 és BstYI-R: 5 -GATCACTACGCAGTCTAC-3, MseI-F: 5 -GACGATGAGTCCTGAG-3 és MseI-R: 5 -TACTCAGGACTCAT-3. A BstYI adapter mix (5 pmol/μl) összetétele: 2,5 μl a 100 μm-os BstYI-F-b l illetve a 100 μm-os BstYI-R-b l és H 2 O 50 μl végtérfogatig. Az MseI adapter mix (50 pmol/μl) összetétele: 25 μl a 100 μm-os MseI-F és a 100 μm-os MseI-R-b l. Az adapter mixet 5 percig 65 C-on inkubáltuk, majd szobah mersékleten hagytuk lehülni. Az adapter ligálási mix összetétele: 1 μl BstYI adapter (5 pmol), 1 μl MseI adapter (50 pmol), 1 μl 10 mm ratp (Pharmacia), 2 μl 5 x RL-puffer, 1 μl T4 DNS ligáz (5 U/1 μl) (Pharmacia), 10 U BstYI, H 2 O 10 μl végtérfogatig. Ezt 40 μl templát fragmentumot tartalmazó elegyhez adtuk, majd 37 C-on inkubáltuk 3 órán keresztül. Pre-amlifikációhoz 5 μl-t használtunk a T 10 E 0.1 -el kétszeresre higított adapter ligált elegyb l. Az adaptereknek megfelel primerek BstYIC+ 0 és MseI + 0 esetében: 5 -GACTGCGTAGTGATCC-3 és 5 - GATGAGTCCTGAGTAAN 2-3. A preamplifikációban a szelektív nukleotid nélküli MseI primer párjaként a 3 végen C szelektív nukleotiddal rendelkez BstYI primert használtuk (5. ábra). A reakcióelegy összetétele: 5 μl kétszeresre higított adapter ligált mix, 1,5 μl BstYI + 0 primer (50 ng/μl), 1,5 μl MseI+ 0 primer (50 ng/μl), 2,0 μl 5 mm dntp, 0,2 μl Taq DNS polimeráz (AmpliTaq, Applied Biosystems, 5U/μl), 5 μl 10 x PCR puffer, H 2 O 50 μl végtérfogatig. A PCR reakció körülményei: 25 x 30 másodperc 94 C, 60 másodperc 56 C, 60 másodperc 72 C. A PCR reakciókat Eppendorf Mastercycler készülékben végeztük Szelektív amplifikáció 33 P izotóppal jelölt primerrel Primer jelölés Az AFLP reakcióhoz 5 ng jelölt primert használtunk. A jelölési elegy összetétele: 0,1 μl az 50 ng/μl primer törzsoldatból, 0,1 μl 33 P- -ATP ( 2000 Ci/mmol; Amersham), 0,05 μl 10 x T4 puffer, 0,2 U T4 polinukleotid kináz, H 2 O 0,5 μl végtérfogatig. A mixet 45 percig 37 C-on inkubáltuk, majd a kinázt 10 percig 80 C-on inaktiváltuk. Szelektív PCR reakció

23 23 Anyag és módszer A preamplifikáció reakciótermékét T 10 E 0.1 -el 600 x-ra hígítottuk, majd ebb l 5 l-nyit használtunk templátként a szelektív amplifikációkban. A PCR reakció mix összetétele: 5 μl preamplifikáció termék (600 x-ra hígított ), 0,5 μl jelölt BstYIC + N-primer (10 ng/μl), 6 μl jelöletlen MseI + N-primer (5 ng/μl), 0,8 μl 5 mm dntp, 2 μl 10 x PCR puffer, 0,6 U AmpliTaq-Gold (5 U/μl, Applied Biosystems), H 2 O 20 μl végtérfogatig. A reakció körülményei: 10 perc 94 C, 13 x 30 másodperc 94 C, 30 másodperc 65 C 0,7 C/ciklus, 60 másodperc 72 C, 23 x 30 másodperc 94 C, 30 másodperc 56 C, 60 másodperc 72 C. A szelektív cdns-aflp reakciókat 48 primerkombinációval végeztük el, mindkét primer két szelektív nukleotiddal rendelkezett a 3 végen. A reakciótermékeket 5%-os poliakrilamid gélen választottuk el (Sequigel, Biorad). A szárított gélt Kodak Biomax filmre exponáltuk és a PhosphoImager 445 SI segítségével szkenneltük (Amersham Biosciences) Az AFLP templát elkészítésekor használt pufferek összetétele 10 x RL-puffer: 100mM Tris-HCl (ph 7.5), 100 mm MgAc, 500 mm KAc, 50 mm DTT, 50 ng/μl BSA 2 x STEX: 2 M NaCl, 20 mm Tris-HCl (ph 8.0), 2 mm EDTA, 0.2 % Triton X-100 T 10 E 0.1 : 10 mm Tris-HCl (ph 8.0), 0.1 mm EDTA (ph 8.0) Az AFLP sávok jellemzése A differenciáltan expresszálódó géneknek megfelel sávokat az autoradiogram alapján a gélb l kivágtuk, és vízben oldottuk 1 órán keresztül. A fragmentumok újrafelszaporításához 2 μl-t használtunk templátként, a szelektív reakcióban használt primerekkel. A reakcióelegy a következ összetev ket tartalmazta: 2 μl templát, 1 x reakció puffer, 0,4 μl dntp (10 mm törzsoldat), 0,8 μl MgCl (25 mm törzsoldat), 0,6 μl BstC primer, 0,6 μl Mse primer (10 μm törzsoldat), 1,1 Unit Red-Taq DNS polimeráz (Sigma). A reakció körülményei a következ k voltak: 2 perces 94ºC-os el ciklus után 10 másodperc 94ºC, 30 másodperc 55ºC és 30 másodperc 72ºC lépések következtek 35-ször ismételve, majd 15 perces 72ºC-on történ utópolimerizációval zárult. A PCR terméket 1,0%-os, EtBr-dal festett gélen futtattuk. Szekvenáláshoz a 150 bp-nál kisebb méret fragmentumokat TA-klónozással a pcr2.1 plazmidba (Invitrogen) ligáltuk, majd a plazmidokkal E. coli (INV F ) kompetens sejteket transzformáltunk. Plazmid DNS izoláláshoz a Quantum Prep/BioRad Plazmid Miniprep Kit-et használtuk. A 150 bp-nál nagyobb fragmentumokat közvetlenül a PCR termékb l szekvenáltattuk. A szekvenálási reakciókat az MBK (Mez gazdasági Biotechnológia

24 24 Anyag és módszer Kutatóközpont, Gödöll ), valamint a Genoid Kft. (Budapest) laboratóriumában végeztettük ABI Prism 3100 (Applied Biosystems) készülékkel Az expressziós mintázatok kvantitatív mérése és adatelemzés A gélfotók alapján történ kvantitatív elemzést az AFLP-QuantarPro képfeldolgozó programmal végeztük (Keygene), amely segítségével azonosítottuk és mértük valamennyi AFLP fragmentum intenzitását. Az esetleges mintafelvételi hibákból és a PCR reakció különböz hatékonyságából adódó különbségek kiküszöbölése végett a nyers adatok korrekciójához a teljes sávintenzitást használtuk. Az intenzitási értékeket soronként összegeztük valamennyi primerkombináció esetében, majd minden összegzett értéket elosztottuk a legnagyobb értékkel. Az így kapott értékek a korrekciós faktorok, ezekkel osztottuk a nyers adatokat. A javított adatsor alapján kiszámoltuk valamennyi fragmentum CV értékét (= szórás/ átlag), majd CV = 1,0 küszöbérték fölötti értékekkel rendelkez TDFekkel dolgoztunk tovább. Minél nagyobb a CV érték, annál nagyobbak az expressziós szintbeli különbségek és 3 RACE reakciók A teljes hosszúságú cdns-ek izolálását a cdns-aflp fragmentumok szekvencia információjából kiindulva 5 és 3 RACE reakciókkal végeztük el. A RACE reakciókhoz a Smart RACE kit-el (BD Biosciences) használtuk, templátként mrns-b l kiindulva. Az mrns izolálást zöld és érett gyümölcsb l származó össz RNS-b l a Qiagen cég Oligotex kitjével végeztük. A reakciókban használt primereket az 2. és 3. táblázat tünteti fel. 2. táblázat. Az 5 és 3 RACE reakciókban felhasznált primerek TDF 5 -RACE primer (5 3 ) 3 -RACE primer (5 3 ) C11M32M003 GTTTTGGCCATCTGCACGCATGTA GAAGAATATGGGTCGTGGAGTCA C24M33M004 CTTGGATGAGTTTGGGAGCTGAAA AGAGAAGCAGAGCTGCAGAAGTTCA C14M13M002 CTCGGATTCTGGTTGGAACTCACT CTAGTGAGATCCATCCTCCGAATAGT C14M21M006 CTGGGAGAAAGAGAAGCCAAGACCAT CAAGCTTGGGGAACTTAGGGATGCT C24M43M007 AATGAGATTTGGGATGGTCCTGATC TGTCCTTGTCTACACCGTCTTCTC C24M44M003 TGCCACAGAACATGTTGCTCAAGC GAGACAGAGGGTTCTTGCAGTAATAGA C24M33M010 AGGTGGATTGCTGGGTGCAGGAAGGT CAAGCTTGGGGAACTTAGGGATGCT 3. táblázat. Az 5 RACE reakciókban felhasznált primerek TDF 5 -RACE primer (5 3 ) C23M42M006 AGCTCCTCTCAAGCGAATGAGTAGCT C24M14M007 AAGGCAGGTATTCAGCAAGGTGTA

25 25 Anyag és módszer 3.3. A szamóca ACS, ACO és CTR1 részleges és teljes cdns-ek izolálása Az ACS, ACO és CTR1 részleges szekvenciákat a 4. táblázatban felsorolt primerpárokkal szaporítottuk fel RT-PCR-ben. A PCR reakcióelegy összetétele: 2,5 μl cdns, 1,5 μl forward primer, 1,5 μl reverse primer (10 μm törzsoldat), 0,8 μl dntp mix (5 mm törzsoldat), 2,5 μl 10 x puffer, 0,25 μl Pfu polimeráz (5 U/μl, Fermentas), H 2 O 25 μl végtérfogatig. A reakció körülményei: 1 x 94 C 2 perc, 30 x (94 C 30 másodperc, 55 C 30 másodperc, 72 C 1 perc), 1 x 72 C 5 perc. A PCR terméket a QIAquick (Qiagen) oszloppal tisztítottuk, majd 20 percig 72 C-on inkubáltuk Taq polimeráz kíséretében az 'A' végek szintetizálása végett (inkubációs elegy összetétele: 20,3 μl tisztított PCR termék, 1 μl MgCl2 (50 mm törzsoldat), 2,5 μl 10 x puffer, 0,2 U Taq (5 U/μl)). A terméket TA-klónozással a pcr2.1 plazmidba (Invitrogen) ligáltuk, majd a plazmidokkal E. coli (INV F ) kompetens sejteket transzformáltuk. Ezekb l a szekvenciákból kiindulva izoláltuk a három gén teljes hosszúságú cdns-ét 5 és 3 RACE módszerrel. A reakciókban használt primerek a 4. és 5. táblázatban vannak felsorolva. 4. táblázat. Az ACS, ACO és CTR részleges cdns-ének izolálásához RT-PCR-ben használt degenerált oligonukleotidok Gén Primer szekvencia (5 3 ) Hivatkozás ACS-F CARATGGGNYTNGCNGARAA Q M G L A E N ACS-R GCRAARCANCANCKRAACCA W F R V C F A Cazonnelli et al. (1998) ACO-F CGC(GGATCC)GCNTGYSARAANTGGGGNTT K M P V R T G V ACO-R AAA(CTGCAG)NGGYTCYTTNGCYTGRAAYTT F Q A K E P R F Nakatsuka et al. (1998) CTR1-F ATGGAGCAAGAITTICATGCTGAGCG M E Q D F H A E R CTR1-R ATCTCGITIAACTTCIGGTGCCATCC W M A P E V N R D El-Sharkawy et al. (2003) A primerszekvenciák alatt feltüntettük a primerek alapjául szolgáló aminosavszekvenciákat is. 5. táblázat. Az FaACO, FaACS, FaCTR1 gének teljes hosszúságú cdns-ének felszaporításához használt 5 és 3 RACE primerek Gén 5 RACE Primer szekvencia (5 3 ) 3 RACE Primer szekvencia (5 3 ) ACO CGTGTCCAGAAACACAGTGGGTAT GATGACAAGGTCAGTGGC ACS CTAGGCTGAGTGAACACAGTGGCAGCA GCAACCGGAGCTCATGAAGATGAT CTR1 GGCCAGGTTTATGCAACAGCCTATACA GGAATCCTCCCATTGTTCATCGAGAT

26 26 Anyag és módszer 3.4. Genomi DNS izolálás Genomi klónok és promoterek izolálásához szükséges genomi DNS-t fiatal szamócalevélb l izoláltuk a Qiagen cég Plant DNeasy Mini Kit-jével Genomi klónok izolalása A teljes hosszúságú cdns-ek szekvenciainformációját felhasználva a genomi klónok felszaporításához használt primereket az 5' és 3' UTR-ekre terveztük, úgy, hogy azok lehet leg a klónok legvégén helyezkedjenek el (6. táblázat.). 6. táblázat. FaACS, FaACO, FaNit, FaHd genomi klónok izolálásához használt primerek Gén Forward primer (5 3 ) Reverse primer (5 3 ) FaACS TTCAGTGCATCATCAACAAGTTCCCAA CTCTTTGATGGGAAACTTCGATGAG FaACO TTGAGCCAACACTCGAGAGAAAGA GGTAAATCACTCCCTACAGAAGTA FaNit TCAAGGCTCATCTTTTACACACACA ACTAAAAGATATGAACCGTTGGCA FaHd TCAACATGATAGCTGCCAGATTCTCA AGAAAACTCATACAGCATCATTGGT FaRingH2 TCTAGTTGCCAAAATACAACTATC GTAGACGTGTAAGATTCTTCATAA 3.6. Promoterek izolálása A promoter izolálás Michiels et al. (2003) TAIL-PCR (Thermal Asymmetric InterLaced PCR) módszerével történt. A felhasznált degenerált (AD) és génspecifikus primer szekvenciákat a 7. táblázatban tüntettük fel. A reakcióelegy összetétele és a reakciókörülményeket a 8. és 9. táblázatban részleteztük. 7. táblázat. A FaCTR1 és FaACS promotereinek izolálásakor TAIL-PCR-ben használt génspecifikus (Pro1-Pro3) és degenerált primerek (AD) FaCTR1 promoter FaACS1 promoter AD2 CATCGNCNGANACGAA Pro1 TCCCGATCCGATTCGACGGCGGATT Pro2 CGGTACCCTCCTCCTCCCGTCTC Pro3 CCTCTGCCGTCCACCTTGGCCT AD1 TGAGNAGTANCAGAGA Pro1 CTCTGGCAAGCCATGATAGTCTTGAAA GATGGC Pro2 AAGGCAATCATCTTCATGAGCTCCGGT TGCG Pro3 GGGAACTTGTTGATGATGCACTGAATAG

27 27 Anyag és módszer 8. táblázat. A TAIL-PCR-ben használt reakcióelegy összetétele els dleges, másodlagos és harmadlagos reakciók során Komponensek Els dleges reakció Másodlagos reakció Harmadlagos reakció Templát DNS 2 μl (40-80 ng) 2 μl az els dleges reakciótermék 50 x-es higításából 10 x PCR puffer 2,5 μl 2,5 μl 2,5 μl MgCl 2 (50 mm) 1 μl 1 μl 1 μl dntp mix (10 mm) 0,5 μl 0,5 μl 0,5 μl 1 μl a másodlagos reakciótermék 10 x-es higításából Génspecifikus primer (10 μm) 1 μl CTR1Pro1 v. ACSPro1 1 μl CTR1Pro2 v. ACSPro2 1 μl CTR1Pro3 v. ACSPro3 Degenerált (AD) primer (10 μm) 5 μl 5 μl 0,5 μl Taq DNS-polimeráz (5 U/ μl) 0,25 μl 0,25 μl 0,25 μl H 2 O 25 μl végtérfogatig 25 μl végtérfogatig 25 μl végtérfogatig 9. táblázat. A TAIL-PCR reakciókörülményei (Michiels et al. 2003) Reakció Ciklusszám H mérséklet és Id tartam Els dleges Másodlagos Harmadlagos 1 95 C-5 perc 5 94 C-30 s, 62 C-1 perc, 72 C-2,5 perc 1 94 C-30 s, 25 C-r l - 72 C-re 3 perc alatt, 72 C-2,5 perc 94 C-20 s, 68 C-3,5 perc C-20 s, 68 C-3,5 perc 94 C-30 s, 42 C-1 perc, 72 C-2,5 perc 1 72 C-5 perc 94 C-20 s, 68 C-3,5 perc C-20 s, 68 C-3,5 perc 94 C-30 s, 42 C-1 perc, 72 C-2,5 perc 1 72 C-5 perc C-30 s, 42 C-1 perc, 72 C-2,5 perc 1 72 C-5 perc 3.7. Szemi-kvantitatív RT-PCR analízis A cdns-aflp-vel izolált néhány gén esetében az expressziós mintázatok ismétlése és jellemzése céljából szemi-kvantitatív RT-PCR-t végeztünk. A cdns szintézist 2,5 μg össz- RNS-b l SuperScript II reverz transzkriptázzal végeztük (Invitrogen). A reverz transzkripció el tt az RNS mintákat DNázzal (Promega) kezeltük. Az RT-PCR körülményei: 1 x 94 C 2 perc, N x 94 C 30 másodperc, X C 30 másodperc, 72 C 30 másodperc és 1 x 72 C 5 percig, ahol N a ciklusok száma és X C a primer olvadásh je és génenként változó (10. táblázat). A PCR exponenciális fázisának tükrözéséhez szükséges megfelel ciklusszám

28 28 Anyag és módszer meghatározásához a PCR terméket 20, 25, 27 ciklus után futtattuk meg EtBr-el festett 1,5%- os agaróz gélen. A PCR reakciókat icycler készülékben végeztük (BioRad). 10. táblázat. Szemi-kvantitatív RT-PCR-ben használt primerek, ciklusszám Ciklus Gén Forward primer (5 3 ) Reverse primer (5 3 ) szám FaRing TCTAGTTGCCAAAATACAACTATC GTAGACGTGTAAGATTCTTCATAA 20 FaSpa AGAGAAGCAGAGCTGCAGAAGTTCA CTTGGATGAGTTTGGGAGCTGAAA 25 FaNit GAAGAATATGGGTCGTGGAGTCA GTTTCCAGCTGGTCCACCAAAGAGTA 20 FaHd GAGACAGAGGGTTCTTGCAGTAATAGA TGCCACAGAACATGTTGCTCAAGC 25 FaRLK1 CAAGCTTGGGGAACTTAGGGATGCT CTGGGAGAAAGAGAAGCCAAGACCAT 25 FaRLK2 GGGAGAAGGGATATGAGATTATTACTG GCCTTTGACATTGTTGGTCGTA 25 Kontrollként a konstitutív expressziót mutató szamóca FaGAPDH gént (AF421145) (glicerinaldehid-3-foszfát dehidrogenáz) használtunk (forward primer: 5 - ATTAGGATCGGAATCAACGG-3, reverse primer: 5 -GTAACCCCATTCGTTGTCGTA- 3 ). A génspecifikus primerek és az alkalmazott PCR ciklusszám a 10. táblázatban vannak felsorolva. A reakcióelegy összetétele: 2,5 μl cdns, 0,6 μl forward primer, 0,6 μl reverse primer (10 μm törzsoldat), 0,8 μl dntp mix (5 mm törzsoldat), 1 μl MgCl2 (50 mm törzsoldat), 2,5 μl 10 x puffer, 0,25 μl Taq polimeráz (5 U/ μl) (Invitrogen), H 2 O 25 μl végtérfogatig. A reakció körülményei: 1 x 94 C 2 perc, 20 x (94 C 30 másodperc, 55 C 30 másodperc, 72 C 30 másodperc), 1 x 72 C 5 perc Bioinformatikai elemzés A szekvenciák homológia keresését a BLASTN és BLASTX programokkal végeztük (NCBI, National Center for Biotechnology Information). A cdns-aflp-ben differenciáltan experesszálódó TDF-ek csoportosítását a hierarchikus klaszter analízissel végeztük (Eisen et al. 1998). A szekvenálási eredményeket az EditSeq (DNASTAR, Inc.) programcsomaggal elemeztük. A RACE és TAIL-PCR reakciókkal kapott szekvenciákat SeqMan software-el (DNASTAR, Inc.) illesztettük össze. A fehérje összehasonlítást és kladogram készítésekor a ClustalW programot használtuk (Thompson et al. 1994). A promoterek bioinformatikai elemzésekor a PLACE (Higo et al. 1999) és PLANTCARE (Rombauts et al. 1999) programokat/adatbázisokat használtuk. A fehérjeszinten található domének azonosítását a SMART (Letunic et al. 2004) és Pfam software-ekkel (Sonnhammer et al. 1998) végeztük.

29 29 Anyag és módszer 3.9. Rizs protoplaszt izolálás és a FaRing-GFP, FaHd-GFP fúzió tranziens expressziója A pbi 121 vektorban (Clontech) a GUS-t GFP-vel cseréltük ki amit a 35S GFP ppcv plazmidból XbaI és SacI-el emésztettünk ki. Az új vektort pbi121gfp-nek neveztük el (6. ábra). RB LB NOS-Pro NPT II (Kan R) NOS-ter CaMV 35SPro GFP NOS-ter 6. ábra. A pbi121gfp vektor szerkezete A FaHd kódoló régióját a Hdfwd: 5'-TCAACATGATAGCTGCCAGATTCTCA-3 és Hd5RACE: 5 -TGCCACAGAACATGTTGCTCAAGC-3 primerekkel Pfu polimerázzal (Fermentas) piros gyümölcsb l izolált RNS-b l szintetizált cdns templáton szaporítottuk fel. A PCR terméket TA klónozással ligáltuk a ptz57r/t plazmidba (Fermentas), majd innen az inszertet az XbaI és SalI enzimekkel hasítottuk és ligáltuk a pbi121gfp plazmidba a CaMV 35SPro után. A FaRing kódoló régióját a BamHI hasítóhelyet tartalmazó (aláhúzva) Ringfwd: 5'- ATGGATCCTCTAGTTGCCAAAATACAACTA-3' és Ringrev: 5'- CCAAAAGCAGGAGGTCTCCT-3' primerekkel szaporítottuk fel zöld gyümölcsb l izolált RNS-b l szintetizált cdns-r l. A PCR terméket TA klónozással ligáltuk a pgem-t Easy plazmidba (Promega), majd innen az inszertet BamHI és SalI enzimekkel hasítottuk és ligáltuk a pbi121gfp vektorba a CaMV 35Spro után. A vektorok helyes szerkezetét szekvenálással ellen riztük. A transzformáláshoz használt protoplasztot rizs-sejtszuszpenzióból (Oryza sativa, Taipei 309 fajta) nyertük a Jenes et al. (1992) által leírt módszerrel. Két ml-nyi sejtszuszpenzióhoz 10 ml enzim oldatot adtunk, majd 3 órán keresztül inkubáltuk szobah n, enyhe (30 rpm) rázatás mellett. A sejtszuszpenziót 75 μm-es, majd 35 μm steril sz r n mostuk át mosó oldat felhasználásával, majd rpm-en 5 percig centrifugáltuk. A sejteket 10 ml mosó oldatban szuszpendáltuk, majd az oldathoz 1 ml transzformációs oldatot és 20 μg-nyi plazmidot adtunk a 35S: GFP (kontroll), 35S: FaRing-GFP és a 35S: FaHd-GFP vektorokból. Az elegyet alaposan összeráztuk. Az 1 ml PEG 4000 (30%) fokozatos hozzámérése után a szuszpenziót 30 percig szobah n inkubáltuk, majd fokozatosan mosó oldattal 10 ml-ig hígitottuk, és 700 rpm-en 5 percig centrifugáltuk, a mosást megismételtük, majd a sejteket 4 ml RY-2 táptalajban szuszpendáltuk, és 28 ºC-on sötétben inkubáltuk 48 órán át. A

30 30 Anyag és módszer kiértékelést Olympus IMT-2 inverz fénymikroszkóppal végeztük, a fényképeket pedig Nikon D-100 fényképez géppel készítettük A Rizs protoplaszt izolálás és a FaRing-GFP, FaHd-GFP fúzió tranziens expressziójához használt oldatok, táptalajok Enzim oldat: 100 ml oldathoz: 1 g Onozuka RS celluláz (Sigma), 0,1 g pektoliáz (Sigma), 6,50 ml glicerin, 1 g CaCl 2 x 2 H 2 O, 0,1 g MgSO 4 x 7 H 2 O, 0,05 g KH 2 PO 4, ph: 5,8. Mosó oldat: 154 mm NaCl, 125 mm CaCl 2, 5 M KCl, 5 M glükóz, ph: 6. MaMg transzformációs oldat: 0,4 M mannit, 15 mm Mg Cl 2, 0,1% MES. Az RY-2 táptalaj összetételét a 11. táblázatban soroltuk fel. 11. táblázat. RY-2 táptalaj rizs protoplaszthoz (Yamada et al. 1986) Ásványi sók mg/l Szerves savak mg/l (NH4) 2 SO 4 67 Riboflavin 0,1 KNO Aszkorbin sav 1 KH 2 PO Retinol 0,005 CaCl 2 x 2 H 2 O 440 D3 vitamin 0,005 MgSO 4 x 7 H 2 O 370 Vitaminok B12 vitamin 0,005 MnSO 4 x 4 H 2 O 22,30 Nikotinamid 1 Egyéb kiegészít k Fe/Na 2 - EDTA 19,25 Piridoxin HCl 1 Inozit 100 KI 0,83 Tiamin HCl 10 2,4-D 5 H 3 BO 3 6,20 D-Ca-pantotenát 0,5 MES 1 mm ZnSO 4 x H2O 8,60 Folsav 0,2 Borjú szérum 8 ml/l Na 2 MoO 4 x H 2 O 0,25 p-aminobenzoesav 0,01 Glükóz 0,45 M CuSO 4 x 5 H 2 O 0,025 Biotin 0,005 CoCl 2 x 6 H 2 O 0,025 Kolin klorid 0,5

31 31 Eredmények és megvitatásuk 4. EREDMÉNYEK ÉS MEGVITATÁSUK 4.1. A szamóca ACC-szintáz izolálása és expressziós mintázata Az etilén bioszintézisében szerepl gének izolálásához a kiindulási alapot Cazzonelli et al. (1998) közleménye jelentette, amely az érés indukálta ACC szintáz és oxidáz cdns-ek izolálásáról számol be a szintén nem-klimaktérikus ananászból. A Cazzonelli et al. (1998) által leírt degenerált ACS-F és ACS-R primerekkel (4. táblázat) 1200 bp-nyi fragmentumot amplifikáltunk cdns templátról és 1300 bp-nyit genomi DNS-r l (7. ábra). Szemi-kvantitatív RT-PCR-el, 25 PCR ciklus után a transzkriptum zöld, Botrytis cinerea-val fert zött érett gyümölcsben és az inda csúcsi részében volt detektálható (7. ábra. A.). 35 PCR ciklus után a transzkriptum detektálható volt az öreg levélben és indában is (7. ábra. B.). A. 500 bp B. 500 bp M M 7. ábra. Az ACS-F és ACS-R primerpárral RT-PCR-ben felszaporított amplikonok. A.: 25 PCR ciklus, B.: 35 ciklus. 1., 2,. 3,. 4. minták: zöld, fehér, rózsaszín és érett érési stádiumban lev gyümölcshús, 5. és 6. Botrytis cinerea-val fert zött érett és túlérett gyümölcs. 7. fiatal levél, 8. öreg levél, 9. inda, 10. inda csúcsa, 11., 12. genomi DNS. M: DNS molekulatömeg marker (Fermentas, GeneRuler 100 bp DNA Ladder Plus: 3.0, 2.0, 1.5, 1.2, 1.031, 0.9, 0.8, 0.7, 0.6, 0.5, 0.4, 0.3, 0.2, 0.1 kb). Az 1200 bp és 1300 bp fragmentumokat nyilak jelölik. A teljes hosszúságú cdns-t zöld gyümölcsb l izoláltuk 5 és 3 RACE reakció segítségével. A 1900 bp-nyi cdns 138 bp 5 és 289 bp 3 UTR által határolt 1473 bp ORFb l áll. Az izolált ACS gén elnevezése FaACS, hivatkozási száma a GenBankban: AY Nukleotid szinten a legnagyobb homológiát (84%) az alma (Malus domestica L.) MdACS-5B (AB034993) génjével valamint a körte (Pyrus communis L.) PcACS5 (AF386523) (84%) génjével mutatta. Fehérje szinten szintén az alma MdACS5 (BAA92351) és körte PcACS génjével (AAL66205) mutatta a legnagyobb azonosságot (71%, illetve 70%). Nagyfokú homológiát (65% illetve 66%) mutat továbbá a szintén nem klimaktérikus gyümölcsök

32 32 Eredmények és megvitatásuk csoportjába tartozó narancs (Citrus sinensis L.) ACS génjével (CAB60721), valamint a papaja (Carica papaya L.) ACC szintázzal (AAC98809). A felsorolt fajok ACC szintáz génjei valamint az általunk klónozott szamóca ACC szintáz gén által kódolt fehérjék ClustalW programmal történt összehasonlításának eredménye a 9. A. ábrán látható. A FaACS teljes hosszúságú genomi klón 2578 bp, 4 exonból és 3 intronból áll (8. és 10. ábra), más ACS génekhez hasonlóan, mint például az Le-ACS2 (paradicsom, X59139; Rottmann et al. 1991), AtACS1 (Arabidopsis; Liang et al. 1992) és MdACS1 (alma, AAA73941; Harada et al. 1997). Az intronok méreti eloszlása a paradicsom ACS2 génjében is a szamócáéhoz hasonló, az els két intron 91, illetve 84 bp, míg az utolsó 880 bp (Rottmann et al. 1991). 1. Intron 85 bp 2. Intron 131 bp 3. Intron 463 bp ATG 1. Exon 171 bp 2. Exon 133 bp 3. Exon 161 bp 4. Exon 1007 bp TAG 5' UTR 138 bp ORF 1473 bp 3' UTR 289 bp 8. ábra. A FaACS genomi klón szerkezete. A szamóca ACC-szintáz 12 aminosavból álló aktív centruma (SLSKDMGFPGFR) (Kende 1993) azonos az összehasonlított fehérjék többségében, kivéve a paradicsom ACS2 és az alma ACS1 enzimeket (9. ábra. A.). Az enzim tartalmazza az ACC szintázokra és különböz aminotranszferázokra jellemz 11 aminosavat (Rottmann et al. 1991), valamint a szubsztrátspecificitást biztosító glutamátot (McCarthy et al. 2001). Bár az ACC szintázok legkevésbé konzervált régiója a C-terminális vég (Kende 1993), néhány ACC szintázban azonban jelen van egy rövid, RLSF (R-arginin, L-leucin, S-szerin, F- fenilalanin) aminosavakból álló konzervált motívum (9. ábra. A.).

33 A. MdACS5 MGFTLSN----QQQLLSKIATGNGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLAEN PcACS5 MGFTLSN----QQQLLSKMATGDGHGENSPYFDGWKAYDSDPFHPTKNPNGVIQMGLREN FaACS MGFTLSN----QQQLLSKIATGTGDSENTPYFDGWKAFDSDPYHPTTNPQGVIQMGLAEN CpACS MVLMLRN----QE-LLSKIATSNGHGEDSPYFDGWKAYDSDPFHPTQNPEGVIQMGLAEN CsACS MAFALSN----QVQLLSKIAAGNGHGEDSPYFDGWKAFESDPYHPTKNPNGVIQMGLAEN Cs-ACS2 MVLVSSNDNGNAKKVLSKLAKGNGHGEDSSYFDGWKAYDSDPFHPIINPRGVIQMGLAEN Me-ACS2 MVLVSSNDNGNAKKVLSKLAKGNGHGEDSSYFDGWKAYDSDPFHPIINPRGVIQMGLAEN Cm-ACS3 MVLVSSN----ANNLLSKLAKGNGHGEDSPYFDGWKAYDTDPFHPIMNPRGVIQMGLAEN Le-ACS2 MGFEIAK----TNSILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAEN MdACS MRMLSRNATFNSHGQDSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAEN MdACS5 QMCFDLIQEWILNNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVT PcACS5 EMCFDLIQEWVLNNPEASICTAAGVNEFKDIAIFQDYHGLPEFRNAVTNFMGRVRGNRVT FaACS QLSFDLIQEWVLKNPEASICTAQGAKEFKDTAIFQDYHGLPEFRNAVANFMGKVRGNRVT CpACS QLCFNLIHEWLLKNPEASICTAQGAAEFRDIAIFQDYHGLAEFREAVAKFMGKVRRNRAS CsACS LLCHELVEDWLMNNPKASICSAEGLNEFKGIAIFQDYHGLPEFRNAVAKFMGKVRGNRIT Cs-ACS2 QLSFEFVEKWMKNNPRASICSVEGIDEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVK Me-ACS2 QLSFEFVEKWMKNNPQASICSVEGIDEFKDIAIFQDYHGLPEFRNAVANFMGKVRGNRVK Cm-ACS3 QLSFEFVEDWIKNNPQASICSVEGLDEFKDIAIFQDYHGLPEFRNAWRILWGKVRGDRVK Le-ACS2 QLCLDLIEDWIKRNPKGSICS-EGIKSFKAIANFQDYHGLPEFRKAIAKFMEKTRGGRVR MdACS1 QLCFDLLESWLAKNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVT MdACS5 FDADRIVMSGGATGAHEMIAFCL-ADPGDAFLVPVPYYPGFDRDLGWRTGVQLIPVACDS PcACS5 FDADRIVMSGGATGAHETIAFCL-ADPGDAFLVPVPYYPGFDRDLGWRTGVQLIPVACDS FaACS FNPDRIVMSGGATGAHEDDCLLLGLIPERDFWCQFLIIQDSIEDLRWRTGVQLLPVACES CpACS FDPDRIVMSGGATGAHEMIAFCL-ADPGDAFLVPTPYYPGFDRDLRWRTGVKLIPVVCES CsACS FDPDRIVMSGGATGAHETVAFCL-ADPGDAFLVPTPYYPGFDRDLRWRTGVQLVPVVCDS Cs-ACS2 FDPDRVVMSGGATGAHETMAFCL-ADPGEAFLVPVPYYPGFDRDLRWRTGVEIVPVICES Me-ACS2 FDPDRVVMSGGATGAHETMAFCL-ADPGEAFLVPVPYYPGFDRDLRWRTGVEIVPVKCES Cm-ACS3 FDPDRVVMSGGATGAHETVAFCL-ADPGEAFLVPVPYYPGFDRDLRWRTGVKIVPVVCNS Le-ACS2 FDPERVVMAGGATGANETIIFCL-ADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCES MdACS1 FDPNHLVLTAGATSANETFIFCL-ADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTS MdACS5 SNNFKVTRAALEAAYEKAQKANIRVKGLLITNPSNPLGTVLDRDTLISLVTFINEKKIHL PcACS5 SNNFEVTRAALEAAYEKAQKANIRVKGLLITNPSNPLGTVLDRDTLRSSVTFINEKKIHL FaACS SNNFKITRAALEDAYEKAQKANIRVKGLIITNPSNPLGTILDRETLKSLVTFINEKNIHL CpACS SNDYQITIEALEAAYETAQEADIKVKGLLIPNPSNPLGTIITKDTLEALVTFTNHKNIHL CsACS SNDFKVTMEALEAAYEKAQESNIRIKGVLITNPSNPLGTFLDRETLKDIVSFINEKNIHL Cs-ACS2 SNNFKLTREALETAYEEAQKSNIKIKGLLITNPSNPLGTVYDRQTLETAVSFINEKNIHL Me-ACS2 SNNFKLTREALETAYEEAEKSNIRIKGLLITNPSNPLGTVYDRQTLETAVSFINEKNIHL Cm-ACS3 SNNFKLTREALETAYEKAQESNIKIKGLLITNPSNPLGTVCDRQTLETAVAFINQKKIHL Le-ACS2 SNNFKITSKAVKEAYENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHL MdACS1 SNGFQITETALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHL MdACS5 VCDEIYAATVFS-QPSFISIAEIIEEN--IGCNRN-----LIHIVYSLSKDMGFPGFRVG PcACS5 VCDEIYAATVFS-QPSFISIAEIIEEN--IGCNRN-----LIHIVYSLSKDMGFPGFRVG FaACS VCDEIYAATVFT-QPRFISIAEILEEED-VVCNRD-----LVHIVYSLSKDMGFPGFRVR CpACS VCDEIYAATVFS-QPEFTSIAEIIEEDK-ICCNRD-----LIHIIYSLSKDMGFPGFRVG CsACS VCDEIYAATVFTKEPSFVSIAEIIDQD--IACNRN-----LIHIVYSLSKDMGFPGFRVG Cs-ACS2 VCDEIYAATVFA-EPGFISISEVIDNS-DIECDRN-----LVHVVYSLSKDMGFPGFRVG 33 Eredmények és megvitatásuk Me-ACS2 VCDEIYAATVFA-EPGFISISEVIDNMNDVECDRN-----LIHVVYSLSKDMGFPGFRVG Cm-ACS3 VCDEIYAATVFT-EPGFISISEVIEND--TKCDKN-----LIHVVYSLSKDMGFPGFRVG Le-ACS2 VCDEIYAATVFD-TPQFVSIAEILDEQEMTYCNKD-----LVHIVYSLSKDMGLPGFRVG MdACS1 ISDEIYSGTAFS-SPSFISVMEVLKDR---NCDENSEVWQRVHVVYSLSKDLGLPGFRVG MdACS5 -IVYSYNDAVVNC-ARKMS-SFGLVSTQTQHLIASMLSDNEFVKRFIAQSAKRLKTRHMR PcACS5 -IVYSYNDAVVNC-ARKMS-SFGLVSTQTQHLIASMLSDNEFVERFIAQSAKRLKTRHMR FaACS NTRTHYNDAVSGLRAEKMSRSSGWVSTQTQCLIASMLSDNEFVDRFIVESAKRLEARHTK CpACS -IVYSYNDAVVSC-ARKMS-SFGLVSSQTQYLIASMLADDEFVDQFIVESRKRLAMRHSF CsACS -IIYSYNDQVVSC-ARKMS-SFGLVSSQTQHLIATMLSDDQFVEKFIAESAKRIAERHKA Cs-ACS2 -IIYSYNDAVVAC-ARKMS-SFGLVSSQTQYLIASMLLDDVFVDNFLAGSAEKLAARHRN Me-ACS2 -IIYSYNDAVVAC-ARKMS-SFGLVSSQTQYLIASMLSDDVFVDNFLAGSAEKLAVRHRN Cm-ACS3 -IIYSYNDAVVNC-ARKMS-SFGLVSSQTQHLIASMLSDDEFVESFLVGSAKKLAARHRN Le-ACS2 -IIYSFNDDVVNC-ARKMS-SFGLVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKH MdACS1 -AIYSNDDMVVAA-ATKMS-SFGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKK MdACS5 FTMGLAQVSTNCLK-SNGGLFVWMDLRRLLKEQTFEAEMVLWRTIIHEVKLNVSPGSSFH PcACS5 FTMELAQVGTSCLK-SNGGLFVWMDLRRLLKEQTFEAEMELWRTIIHEVKLNVSPGSSFH FaACS FTEGLEEQGTTCLK-SNGGLFVWMDLHKHLKEQTFEAEMALWRTIINIVKLNVSPGVSFH CpACS FTQRLAQVGINCLK-SNAGLFVWMDLRRLLKEQTFEAEMVLWRVIINEIKLNVSPGSSFH CsACS FTWGLSQVGIGCLK-SNAGLFLWMDLHHLLKEQTYEAEMALWRVIINEVKLNVSPGSSFH Cs-ACS2 FTKGLAQVGIGYLK-GSGGLFLWMDLRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFH Me-ACS2 FTKGLAQVGIGYLK-GSGGLFLWMDLRHLLKEKTLEAEMALWKVIINEVKLNVSPGSSFH Cm-ACS3 FTRGLAQVGIGYLR-GSGGLFLWMDLRHLLTEKTLEAEMALWRVIINDVKAECVAGVVFP Le-ACS2 FTNGLEVVGIKCLK-NNAGLFCWMDLRPLLRESTFDSEMSLWRVIINDVKLNVSPGSSFE MdACS1 LVSGLQKSGISCLN-GNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCH MdACS5 CP-EPGWFRVCFANMDDKTMEVALTRIRTFVLQNKEAIVP--RKSNRLWHSN-LRLSFQS PcACS5 CP-EPGWFRVCFANMDDKTMEVALTRIRTFVLQDKEAIVP--RKSNRLWKAT-LGSAFQS FaACS CP-QPGWFRVCFANMDAQPMEVALERIRNFVLQDKEAAVVAMKKKKNCWQSKKLSLSFNH CpACS CS-EPGWFRVCFANMDDKTMEIALSRIKTFMLQHKEAMVP---KKKLCWQTS-LRLSFSS CsACS CP-NPGWFRVCFANMDDRTMEIALSRITSFMLKNVEAKVP--NKKKLCWQRS-LRLSMSS Cs-ACS2 CS-EPGWFRVCFANMDDNTMDISITRIRNFVLQNKEVTTK-VKKQKFCWRQSSLELRLSS Me-ACS2 CS-EPGWFRVCFANMDDSTMDISITRIRNFVLQNKEVTTK-VKKQKFCWRQSSLELRLSS Cm-ACS3 LLGSPGWFRVCFANMDDNTMEISITRIRNFVLQNKEVTTK-IKKQKFCWRQSSLELRLSS Le-ACS2 CQ-EPGWFRVCFANMDDGTVDIALARIRRFVGVEKSGDKSSSMEQKQQWKKNNLRLSFSK MdACS1 CT-EPGWFRVCFANLPERTLDLAMQRLKAFVGEYYNVPEVNGGSQSSHLSHS-RRQSLTK MdACS5 RRMDDTMMSPCMMSPHTPIPQSPLVRAT- PcACS5 RRMDDNMMSPCMMSPHTPIPQSPLVRAT- FaACS RRFDEVNMS-----PHSPIPQSPLVRAT- CpACS RYEDIMETPGSFMSPHSPIPQSPLVRART CsACS RRMDDFMAS------PCMSPQSPLVQART Cs-ACS2 RRLEDIMSP------HSPLPQSPMHRATT Me-ACS2 RRLEDIMSP------HSPLPQSPMLRATT Cm-ACS3 RRLEDIMSP------HSPLPQSPMLRATT Le-ACS2 RMYDESVLSP----LSSPIPPSPLVR--- MdACS1 WVSRLSFDD------RGPIPGR

34 34 Eredmények és megvitatásuk B. 9. ábra. A FaACS (Fragaria x ananassa, AAT77723), MdACS5 (Malus domestica, AAA73941 és AB034993), PcACS5 (Pyrus communis, AF386523), CpACS (Carica papaya, U68216), CsACS (Citrus sinensis, AJ012551), Cm-ACS3 (Cucurbita maxima, AB038559), Cs-ACS2 (Cucumis sativus, BAA33375), Me-ACS2 (Cucumis melo D37937), Le-ACS2 és LE-ACS7 (Lycopersicon esculentum, AAP96918 és AAC32317), AtACS6 (Arabidopsis thaliana, NP_192867) és Pe-ACS1 (Populus euphratica, AB033502) aminosavszekvenciák összehasonlítása a ClustalW programmal. A.: Fehérje összehasonlítás. A konzervált aminosavakat keret jelzi. Az aktív centrumot (Kende 1993) a fekete négyzet jelzi, a 11, szürke háttérben lev aminosav az ACC szintázok és különböz aminotranszferázokra jellemz aminosav (Rottmann et al. 1991). A csillaggal jelölt glutamátnak (E) a szubsztrátspecificitásban van szerepe (McCarthy et al. 2001) B.: A rokonsági viszonyt ábrázoló kladogram. A C terminális vég és az ETO1/ EOL fehérjék megköt képessége alapján az ACC szintázok három csoportba sorolhatók (Yoshida et al. 2005): 1. az RLSF konszenzus szekvencia után aminosavból álló szekvencia található (LeACS2, FaACS, stb.), 2. az RLSF el tt WVF konszenzus szekvenciát tartalmazó és az RLSF után rövid (5-8 aminosav), argininben, aszparaginsavban vagy glutaminsavban gazdag aminosavszekvenciával rendelkez enzimek (AtACS5), és 3. RLSF szekvenciát nem tartalmazó izoenzimek (MdACS1). A 2. csoportba tartozó ACC szintázok poszttranszlációs szabályozásában az ETO1 játszik közre (in vitro körülmények közt az ETO1 gátolja az ACS5 aktivitását). A FaACS az els csoportba sorolható, tehát valószín leg posztranszlációs szabályozásában az ETO1 nem vesz részt. A kladogram alapján a FaACS egy klaszterben helyezkedik el a Rosaceae család többi ACS génjeivel (MdACS5, PcACS5), bár ezek a fajok gyümölcsérést tekintve klimaktérikusak, és távolabb helyezkedik el a szamócához hasonló nem-klimaktérikus fajok ACS génjét l. A szamóca FaACS génnel mind nukleotid mind fehérje szinten legnagyobb homológiát mutató alma ACS-5B és ACS-5B géneket (Sunako et al. 2000) levélb l izolálták és expressziójuk sebzés hatására indukálódik. A FaACS-el szintén nagy homológiát mutató körte

35 35 Eredmények és megvitatásuk PcACS5 gént gyümölcsb l izolálták, de expressziójának szabályozásáról nincs adat (El- Sharkawy et al. 2004). A kladogramban a szamóca génhez közelebb helyezkedik el a citrom ACS génje, és távolabb az aktív centrumban is különbséget mutató szintén Rosaceae családba tartozó MdACS valamint a paradicsom LeACS2 génje, amelyek a gyümölcsérés során etilén hatására indukálódnak (Lay-Yee és Knighton, 1995, Barry et al. 2000). A kladogram tehát viszonylag jól tükrözi a fajok rokonsági viszonya mellett, a különböz ACS izoformák fiziológiai szerepe közti hasonlóságot is (9. ábra) A FaACS promoterének izolálása, bioinformatikai elemzése A TAIL-PCR-el felszaporított FaACS promoter régió hossza 889 bp (10. ábra). A PLANTCARE és PLACE adatbázisok (Rombauts et al. 1999, Higo et al. 1999) segítségével azonosított szabályozó elemek közül említésre méltó a cirkadián ritmus szabályozásában szerepet játszó elem (CAANNNNATC) két formája (CAAATCCATC és CAATTGCATC), amelyet el ször a paradicsom klorofill a/b-köt fehérjék promoterében azonosítottak, és a cirkadián szabályozásában vesz részt (Piechulla et al. 1998). Arabidopsis-ban több ACC szintáz gén m ködése, illetve az etilén emissziónak fény-függ, cirkadián szabályozása ismert (Thain et al. 2004), bár a folyamat biológiai jelent sége még nincs feltárva. Jelen vannak különböz stresszválaszért felel s szabályozó elemek, a CAACTG motívum két példánya például szárazság indukálhatóságért felel s MYB transzkripciós faktor köt hely (Abe et al. 2003). A TTTGACT szekvencia elicitor válaszreakcióért felel s, a WRKY gének promoterében azonosították, ezek a transzkripciós faktorok a korai védekezési válaszban résztvev gének m ködését szabályozzák (Eulgem et al. 1999). A TGTCTC motívum auxinválaszért felel s, a korai auxinválasz génjeinek promoterében ARF1 (auxin response factor) köt helyként azonosították (Ulmasov et al. 1999). Az ACGT szekvencia etioláláskor indukálja a génexpressziót, az Arabidopsis erd1 (early responsive to dehydration) gén promoterében mutatták ki (Simpson et al. 2003). Az ACCGAGA és ACCGAC abszcizinsav és szárazságstressz válaszért felel sek (Busk et al. 1997). Hasonló szabályozó elemek azonosítása céljából a FaACS promoterét az AtACS2, AtACS6 és LeACS7 gének promotereivel hasonlítottuk össze (16. ábra). Összehasonlításunkat korlátozta a különböz ACS gének promotereire vonatkozó kevés szekvenciainformáció. A nem utóér gyümölcsök etilén bioszintézisben résztvev gének promotereir l semmiféle adattal nem rendelkezünk, utóér gyümölcsöknél a paradicsomban ismert néhány ACS gén promotere. Adott viszont az Arabidopsis valamennyi ACS gén promoterszekvenciája és némelyik funkcionális jellemzése (Rodrigues-Pousada et al. 1993, Wang et al. 2005).

36 36 Eredmények és megvitatásuk Cactagtgattatcgagtatggagttaaaaaaaaaaaatgtatattatgtttttctttttttgatatatgtatttttgttcaatcaagcccaccgactccctgac caattctgcatcttctttttgtttatacatgattacgtctttattcttcagttcctcagttcatattccgctcttcctcctagtttctcctccttaaatctcaaaaaatc caaatttttggggaaaattttgttgggttttcaattttgtctctaattttcagaattttcttctactttcattgatgcctactttgttttgaatacttattaacgtctact tgagctcttacattttgtatggttgtatctgaaattttttttgcctccggctaaatttgaagcccaccccatatcgaaatctaagatccgccactggtgctattt gagatcgttggttcaaatccatcgaagactctcgatgatgtccgcatttttcattcatcattagagaattgtccgtgtaatttgtgagttgtgaccgtgtacc tagctaactcgttttggttacaaacttcacttggatggtttgactgaattgagactattatgacagttaaggttaccttcaataatgccttggccttgcatgaa gggaaagagaccatgaaacagcgaatccccaactggcttagaatttacttagtttaacactgattgaaaatcaaggcacaaaccaactgccaccgag attttcaaaatcaaagtcgcaacaattgcatcttcatggaaacttccccagaaattcaagaacaaaaagtcctacgcttattttaattatcagagccatctg aacagaacctcatccctaacatctataaataacattcaggaagttgtattctcatccaactacaaaactattcagtgcatcatcaacaagttcccaaag ca ACS PRO3 cttgaccatttagctagctcctctttccccttctttgtagaattctcattgcactaaaggttagatctttgaggcacattacaagaacaatggg ATTCACTTTGAGCAACCAACAGCAACTGTTGTCTAAGATAGCAACCGGTACCGGAGACAGCGAAA ACACTCCATATTTTGATGGCTGGAAGGCCTTTGATAGTGATCCTTACCATCCCACCACCAACCCTCA AGGGGTTATTCAGATGGGTCTTGCAGAAAATCAAgtaagaaatttgaaaccagaaaccttgtattacaagcaacatatcatctcttgg cttttcactaattggtttcttctgtatgcagctttcttttgatttgatccaagaatgggttctgaaaaacccagaagcct CCATTTGCACAGCACAAGGAGCAAAAGAATTCAAGGACACAGCCATCTTTCAAGACTATCATG ACS PRO2 ACS PRO1 GCTTGCCAGAGTTCAGAAATGtatgcattgatcaacatccataaaactttcttagcatcacttgtttaactcactacacaatcttaacgaaataacttt agtccaatattaatttaacaaaatttaattattttctttgaaacttccacaggctgttgcaaatttcatgggaaaagtgagaggaaatc GAGTCACATTCAACCCTGACCGCATTGTTATGAGCGGAGGCGCAACCGGAGCTCATGaAGATGATT GCCTTTTGCTTGGCTtGATCCCGGAGAGGGATTTCTGGTGCCAGTTCCTTATTATCCAGGgctaagctagct gattaagtttatctttctaagattgactttgatccaactaagacaggaaaaactaaactaattgaggccagttgcctaaaattatatgagaaattagcaatatgaaagaga ctgagttgacccttagtttaatgccatccctatgtgtccttggaccagcttgaattattgacgggggaatgaaaacgatctttgtatactaattgccatcatctacctcttttg acaaagatgaaagatgcctcaggaaaattaggaccatttgtgacttgttcatctaaaacgacattacgtacgtaacttcatatagtagctagctaactgcaccaaatacg tccctagttctcgacgaaggattccatgcttagtagtagaatagaatttattcataaccgttgatatattttccatgggttgctttgctaaataagtttttgtacttcattgcaaa ATTCGATAGaAGATTTGAGATGGCGAACTGGGGTACAGCTTCTTCCAGTAGCTTGTGAAAGCTCAA ACAATTTCAAGATCACGAGAGCAGCCTTGGAAGATGCCTATGAGAAAGCACAAAAGGCCAACATC AGAGTTAAAGGCTTGATCATTACCAACCCCTCAAACCCACTAGGCACAATCCTAGACAGAGAGACT CTTAAGAGCTTAGtGaCTTTCATCaATGAGAAGAACATCCACCTAGTCTGTGATGAGATCTATGCTGC CACTGTGTTCACTCAGCCTAGGTTCATCAGCATTGCTGAAATACTGGAGGAAGAAGATGTAGTATG CAACCGCGACCTGGTTCACATTGTCTACAGTCTTTCCAAAGACATGGGGTTCCCTGGCTTTAG GG S L S K D M G F P G F R TAAGGAATACGCGCACTCATTACAATGATGCCGTAAGTGGACTGCGCGCCGAAAAGATGTCGAGG TCTTCGGGTTGGGTTTCTACGCAAACTCAGTGTCTAATTGCATCCATGCTATCAGACAATGAGTTTG TGGATAGATTCATTGTAGAAAGTGCTAAGAGGTTGGAAGCAAGGCACACAAAATTCACTGAGGGA CTTGAGGAACAAGGTACTACTTGTTTGAAGAGCAATGGTGGCTTGTTTGTGTGGATGGACTTGCAC AAACATCTAAAGGAGCAGACTTTTGAAGCAGAAATGGCATTGTGGAGAACCATAATCAATATAGT TAAGCTCAATGTGTCACCTGGTGTTTCTTTTCATTGCCCCCAACCAGGTTGGTTCAGGGTTTGCTTTG CCAACATGGATGCCCAGCCCATGGAAGTTGCTTTGGAAAGAATCAGAAACTTTGTGCTTCAAGACA AGGAGGCAGCTGTGGTCGCAATGAAGAAGAAGAAGAACTGCTGGCAAAGTAAGAAGCTGAGTCTC AGCTTCAATCATCGAAGATTCGATGAGGTCAACATGTCACCGCATTCCCCTATTCCTCAGTCACCTC TTGTTCGAGCCACTTAGagaagtgatgatcatctccatttagttatgcagctagaatcattgatactcatgttttctcttaattagttcctatatttcaatactc taggttaattgttagctaaaataacacaaaaaagaactaagactaggtatgccccctaattggaagctagtcaatacatgcaatgttttcttacctgcagattgcaggtttt tttctttttccgattcagtggaatagtttgtcttagtttgtaatgatttctcatcgaagtttcccatcaaagagttttgagtgctttcaaaaaaaaaaa 10. ábra. A FaACS nukleotid szekvenciája. A feltétlelezett TATA box és poliadenilációs szignál szekvenciák két vonallal vannak aláhúzva. A transzlációs start és stop kodonokat szürke háttér jelöli. Az aktív centrumot alkotó dodekapeptid a megfelel nukleotidszekvencia alatt van feltüntetve. Az ábrán vastag bet vel jelöltük a TAIL-PCR reakcióban a promoter izoláláshoz használt primereket (ACS PRO1 és ACS PRO3, komplementer szál). A nem kódoló szekvenciákat (5' és 3' UTR, intronok) kisbet vel írtuk. A promoterben azonosított cisz elemeket aláhúztuk.

37 37 Eredmények és megvitatásuk Arabidopsis ACS gének közül nukleotid és fehérje szinten a szamóca génnel a legnagyobb homológiát az AtACS2 (At1G01480) és AtACS6 (At1G011280) gének mutatják, összehasonlításunkba emiatt kerültek be ezeknek a géneknek a promoterei, az AtACS2 promotert funkcionálisan is vizsgálták (Rodrigues-Pousada et al. 1993). Az LE-ACS7 (AF043122) expressziójáról bizonyították, hogy levélben sebzés és elárasztás hatására indukálódik (Shiu et al. 1998). Mind a négy promoterben jelen van a sebzési (vagy elicitor), anaerob stressz válaszreakcióért felel s, valamint a dehidratáció és sötétség indukálta szeneszcencia folyamatának szabályozásáért felel s elemek. Az auxinválaszért felel s elem az AtACS6-ban fordul el, míg a szárazság stresszben szerepet játszó szekvencia az AtACS6 mellett az LeACS7 promoterében is fellelhet. A fényindukálhatóságért felel s motívum (TTTCAAA) a szamóca, AtACS2 és LeACS7 promoterekben van jelen. Az AtACS2 promoter funkcionális elemzése szerint is a fény befolyásolja az AtACS2 expresszióját, indukálva azt (Rodrigues-Pousada et al. 1993) A szamóca ACC-oxidáz izolálása és expressziós mintázata Az ACO gén izolálása céljából RT-PCR reakcióban az ACO-F és ACO-R (Nakatsuka et al. 1998) degenerált primerpárt használtuk (4. táblázat). Valamennyi vizsgált mintában felszaporított fragmentum 830 bp méret (11. ábra). Genomiális DNS-t használva templátként a felszaporított fragmentum 1200 bp méret (11. ábra. B). Szemi-kvantitatív RT-PCR-ben, 25 PCR ciklus után a transzkriptum akkumulációja érés specifikus volt, és a gén indukálódott Botrytis cinerea fert zött érett gyümölcsben is (túlérett, fert zött gyümölcsben kevésbe volt detektálható 25 ciklus után, valószín leg a transzkripció gátlása vagy az RNS gyengébb min sége miatt) (11. ábra. A). 35 PCR ciklus után a transzkriptum valamennyi mintában (zöld, fehér, rózsaszín, piros érési stádiumban lev gyümölcshús, Botrytis cinerea-val fert zött érett és túlérett gyümölcshús, fiatal levél, öreg levél, inda, inda csúcsa) jelen volt (11. ábra. B). Az érett gyümölcsb l felszaporított fragmentumot megszekvenáltuk, majd 5 és 3 RACE reakció segítségével sikerült a teljes cdns-t felszaporítani. A teljes cdns hossza 1235 bp, ebb l 963 bp az ORF, 71 bp az 5 UTR és 201 bp a 3 UTR. A szekvencia génbanki összehasonlítása alapján nukleotid szinten a FaACO (AY706156) a legnagyobb homológiát (85%) az alma (Malus domestica L.) ACO génjével (AB086888) valamint a homoki körte (Pyrus pyrifolia L.) PPAOX3 (AB042107) (84%) génjével adja. Fehérje szinten az szibarack

38 38 Eredmények és megvitatásuk (Prunus persica L., CAA54449) és kajszibarack (Prunus armeniaca L., AAC33524) ACO génjével 81%, míg az alma ACO génjével 80% homológiát mutat. A. 500 bp B. 500 bp M M 11. ábra. Az ACO-F és ACO-R primerpárral RT-PCR-el felszaporított fragmentumok. A.: 25 PCR ciklus, B.: 35 PCR ciklus 1., 2,. 3,. 4. minták: zöld, fehér, rózsaszín, piros érési stádiumban lev gyümölcshús, 5. és 6. Botrytis cinerea-val fert zött érett és túlérett gyümölcshús, 7. fiatal levél, 8. öreg levél, 9. inda, 10. inda csúcsa, 11., 12. genomi DNS, M: DNS molekulasúly marker (Fermentas, GeneRuler 100 bp DNA Ladder Plus: 3.0, 2.0, 1.5, 1.2, 1.031, 0.9, 0.8, 0.7, 0.6, 0.5, 0.4, 0.3, 0.2, 0.1 kb). A 830 bp és 1200 bp méret fragmentumokat nyilak jelölik. Bár fehérjeszinten a szamóca és más fajok ACC oxidáza közti homológia nagy, a gének szerkezete különböz. A két intronból és három exonból álló genomi klón (12. ábra) szerkezete eltér az adatbázisokban talált teljes hosszúságú ACO genomi klónokétól. A paradicsom LeACO1 (X58273), a lóhere TrACO1 (DQ112347), petúnia PETACO3 (L21978), gének például három intront tartalmaznak, amelyek pozíciója hasonló, méreteik viszont eltér ek. A FaACO-ban az els intron pozíciója azonos a fent említett gének els intronjával, a második intron megfelel je hiányzik a FaACO-ból, a harmadik intron helye szintén hasonló. 5'UTR71 bp ORF 963 bp 3'UTR201 bp ATG 1. Exon 105 bp 2. Exon 562 bp 3. Exon 293 bp TAA 1. Intron 93 bp 2. Intron 209 bp 12. ábra. A FaACO genomi klón szerkezete.

39 39 Eredmények és megvitatásuk A. FaACO MENFPVINMEKLNGEERNATMETIKDACENWGFFELVNHGIPTVFLDTVEKMTKDHYKNC 60 FaACO ELVSHGIPTEFLDTVEKMTKDHYKNC 26 PaACO MENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC 60 PAO1 MENFPIINLEGLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYRQC 60 MdACO2 MENFPVINLESLNGEGRKATMEKIKDACENWGFFELVSHGIPTEFLDTVERLTKEHYKQC 60 CsACO MENFPVISLENINGAERAAILEKINEACEKWGFFELVNHGIEPEFMDTVERLTKAHYRKC 60 FsACO1 MENFPVINLEKLNGEERGTTMEKIKDACENWGFFELVNHGLPHELLDTVERLAKEHYKKC 60 LeACO1 MENFPIINLEKLNGDERANTMEMIKDACENWGFFELVNHGIPHEVMDTVEKMTKGHYKKC 60 FaACO ELVSHGISHELMDKVEKLTKEHYRKC 26 CpACO MENFPVIDLSKLNGEERASTMELIHDACENWGFFELVNHGISHDLMDTVERLTKEHYKKC box FaACO LEQRFKEPVASKGLNAVNTEVNDMDWESTFYLKHLPRSNISEVPDLDEEYRKVMKDFALK 120 FaACO1 LEQRFKELVASKGLNAVNTEVNDMDWESTFYLKHLPRSNISEVPDLDEEYRKVMKEFALK 86 PaACO LEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKEFALK 120 PAO1 LEQRFKELVASKGLEAVKTEVNDMDWESTFYLRHLPKSNISEVPDLEDQYRNVMKEFALK 120 MdACO2 LEQRFKELVASKGLEGVQTEVKDMDWESTFHLRHLPQSNISEVPDLKDEYRNVMKEFALK 120 CsACO MEQRFKELVASRALEGIQTEVNDMDWESTFYVRHLPQSTINEVPDLDEEYRKVMKEFALK 120 FsACO1 MEQRFKELVTAQGLEGVQTEVNDLDWESTFHVRHLPQSNISEIPDLEDEYRKVMKEFALK 120 LeACO1 MEQRFKELVASKGLEAVQAEVTDLDWESTFFLRHLPTSNISQVPDLDEEYREVMRDFAKR 120 FaACO2 MEQRFKEMVASKGLEAVNSEIEDLDWESTFFLRHLPFSNISQVPDLDEDYREAMKEFAVE 86 CpACO MEQRFKEMVESNGLEAVQSEINDMDWESTFFLRHLPASNMHEIPDLEDDYRKAMKEFAVG 120 FaACO LEKLAEELLDLFCENLGLEEGYLKKAFY-GSQGSPTFGTKVSNYPPCPTPDLIKGLRSHT 179 FaACO1 LEKLAEELLDLFCENLGLEKGYLKKAFY-GSQGSPTFGTKVSNYPPCPTPDLIKGLRSHT 145 PaACO LEKLAEQLLDLLCENLGLEQGYLKKAFY-GTNG-PTFGTKVSNYPPCPNPELIKGLRAHT 178 PAO1 LEKLAEQLLDLLCENLGLEQGYLKKAFY-GTNG-PTFGTKVSNYPPCPNPELIKGLRAHT 178 MdACO2 LEKLAEQLLDLLCENLGLEQGYLKKAFY-GTKG-PTFGTKVSNYPPCPNPDLIKGLRAHT 178 CsACO LEKLAEELLDLLCENLGIEKGYLKKVFH-GANG-PTFGTKVSNYPPCPKPDLIKGLRAHT 178 FsACO1 LEKLAEELLDLLCENLGLEKGYLKKAFH-GSKG-PNFGTKVSNYPPCPKPDLIKGLRAHT 178 LeACO1 LEKLAEELLDLLCENLGLEKGYLKNAFY-GSKG-PNFGTKVSNYPPCPKPDLIKGLRAHT 178 FaACO2 LEKLAEQLLDLLCENLGLEKGYLKKAFY-GSKG-PNFGTKVSNYPPCPKPDLVKGLRAHT 144 CpACO LQKLAEQMLDLLCENLGLEKGYLKKVFY-GSKG-PNFGTKVRNYPPCPKPDLIKGLRAHT box FaACO DAGGDILLFQDDKVSGLQLLKDGEWIDVPPMRHSIVINLGDQLEVITNGKYKSVEHRVIA 239 FaACO1 DAGGVILLFQDDKVSGLQLLKDGEWIDVPPMRHSIVINLGDQLEVITNGKYKSVEHRVIA 205 PaACO DAGGLILLFQDDKVSGLQLLKDGQWIDVPPMRHSIVINLGDQLEVITNGKYKSVEHRVIA 238 PAO1 DAGGLILLFQDDKVSGLQLLKDGQWIDVPPMRHSIVINLGDQLEVITNGKYKSVEHRVIA 238 MdACO2 DAGGLILLFQDDKVSGLQLLKDGEWVDVPPMRHSIVINLGDQLEVITNGKYKSVEHRVIA 238 CsACO DAGGIILLFQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNGKYKSVEHRVVS 238 FsACO1 DAGGIILLFQDDKVSGLQLLKDGQWIDVPPMRHSIVINLGDQLEVITNGKYKSVLHRVIA 238 LeACO1 DAGGIILLFQDDKVSGLQLLKDEQWIDVPPMRHSIVVNLGDQLEVITNGKYKSVLHRVIA 238 FaACO2 DAGGVILLFQDDKV CpACO DAGGIILVFQDDKVSGLQLLKDDQWVDVPPMKHSIVINLGDQLEVITNGKYKSVMHRVIA box FaACO QTDG-TRMSIASFYNPGSDAVIYPAPSLVETETEEKNQVYPKFVFDDYMKLYAVLKFQAK 298 FaACO1 QTDG-TRMSIASFYNPGSDAVIYPAPSLVETETEEKNQVYPKFVFDDYMKP PaACO QTDG-TRMSIASFYNPGSDAVIYPAPTLVEKEAEEKNQVYPKFVFEDYMKLYAGLKFQPK 297 PAO1 QTDG-TRMSIASFYNPGSDAVIYPAPTLVEKEAEEKNQVYPKFVFEDYMKLYAGLKFQPK 297 MdACO2 QTDG-TRMSIASFYNPGSDAVIYPAPTLVEKEAEEKNQVYPKSVFEDYMKLYAGVKFEAK 297 CsACO QTDGEGRMSLASFYNPGSDAVIYPAPALLEKEAEKK-QVYPKFVFEDYMKLYVPLKFQAK 297 FsACO1 QTNG-NRMSIASFYNPGGDAVIYPATALVEKEAEEKNNVYPKFVFEDYMKLYAGLKFQAK 297 LeACO1 QTDG-TRMSLASFYNPGSDAVIYPAKTLVEKEAEESTQVYPKFVFDDYMKLYAGLKFQAK 297 FaACO CpACO QTDG-NRMSLASFYNPGDDAVIYPAPSLVEKEAEK-NQIYPKFVFDDYMKLYVGLKFQAK 296 FaACO EPRFEAMKTVEANPSLAA---IATA 320 FaACO PaACO EPRFEAMKAVETNISLGP---IATA 319 PAO1 EPRFEAMKAVETNISLGP---IATA 319 MdACO2 EPRFEAMKAVEIKASFGLGPVISTA 322 CsACO EPRFEAMKAVETNVNLGP---IATA 319 FsACO1 EPRFEAMKAVESNVTVGP---IATA 319 LeACO1 EPRFEAMKAMESDPIASA FaACO CpACO EPRFEAMKAMESTVTPGAIATV MaACO EPRFEAMKAMEA-VATHP---IATS 318

40 40 Eredmények és megvitatásuk B. 13. ábra. A FaACO (AAU10090) és néhány ACC oxidáz fehérjeszint összehasonlítása: FaACO1 és FaACO2 (Fragaria x ananassa, CAH65482, CAH65483), MdACO2 (Malus domestica, BAC53656), PaACO (Prunus armeniaca, AAC33524), PAO1 (Prunus persica, CAA54449), CpACO (Carica papaya, AAF64528), LeACO1 (Lycopersicon esculentum, CAA41212), CsACO (Citrus sinensis, AAG49361), FsACO1 (Fagus sylvatica, CAD21844), aminosavszekvenciák összehasonlítása a ClustalW programmal. A.: Fehérje összehasonlítás. A kilenc jelölt aminosav megtalálható a dioxigenázok valamennyi Fe (II) aszkorbát tagjában. A 3 konzervált domént (Lasserre et al. 1996) vonal jelzi. A fekete háttérel jelölt 3 aminosav a FaACO és FaACO1 közötti eltérést jelöli. B.: A rokonsági viszonyt ábrázoló kladogram. A FaACO tartalmazza az ACC oxidázok három konzervált doménjét (13. ábra: A, Box 1, Box 2, potenciális leucin cippzár domén, Box 3, vas ion köt domén) valamint m ködésükhöz vasiont és aszkorbátot igényl enzimek csoportjára jellemz 12 konzervált aminosavat (P5, A27, H39, H177, D179, L195, Q196, G218, H234, R244, S246) (Lasserre et al. 1996) (13. ábra. A). A kladogram alapján a FaACO a Trainotti et al. (2005) által leírt FaACO1-hez áll a legközelebb, és egy csoportban van a szintén Rosaceae családba tartozó alma, kajszi és szibarack ACO fehérjékkel, és távolabb helyezkedik el a szintén Trainotti et al. (2005) által leírt FaACO2-t l, amely a paradicsom, papaya, citrom ACO fehérjékkel van egy klaszterben, legtávolabbi rokonságot a bükk ACO-val mutatja (FsACO1) (13. ábra B). A FaACO1 és FaACO2 gének részleges cdns-ek. Elképzelhet, hogy a FaACO-val legközelebbi rokonságot mutató FaACO1 azonos az általunk leközölt génnel, ugyanis az adatbankban meglév parciális szekvencia aminosavszinten csak 3 aminosavban különbözik az általunk leközölt ACO szekvenciától, különbség, ami könnyen adódhat szekvenálási hibákól is (13. ábra. A). Expressziós mintázatukat tekintve a FaACO1 és FaACO2 az általunk leírt FaACO gén mintázatához hasonló, az érés során indukálódik (Trainotti et al. 2005).

41 41 Eredmények és megvitatásuk 4.3. A szamóca CTR1 izolálása és jellemzése Az etilén jelátviteli útban az etilén receptorok (ETR1, ERS1) egy szerin/treonin protein kinázzal, a CTR1-el lépnek kölcsönhatásba, amely az etilén jelátviteli út negatív regulátoraként m ködik (Kieber et al. 1993). Etilén hiányában az etilén receptorok közvetlenül aktiválják a CTR1 kináz aktivitását, ami foszforilálja a downstream célfehérjéket leállítva az etilén jelátviteli útat. Szamócában, más növényfajokhoz hasonlóan, az ETR géncsalád több tagját is azonosították, a CTR1-r l mi számolunk be els ként. A CTR1 degenerált primerpárral (El-Sharkawy et al. 2003) (4. táblázat) RT-PCR-ben egy 423 bp méret fragmentumot szaporítottunk fel (14. ábra). M M 500 bp 14. ábra. Az CTR1-F és CTR1-R primerpárral RT-PCR-el felszaporított fragmentumok. 1., 2,. 3,. 4. minták: zöld, fehér, rózsaszín, piros érési stádiumban lev gyümölcshús, 5. és 6. Botrytis cinerea-val fert zött érett és túlérett gyümölcshús, 7. fiatal levél, 8. öreg levél, 9. inda, 10. inda csúcsa, 11., 12. genomi DNS, M: DNS molekulasúly marker (Fermentas, GeneRuler 100 bp DNA Ladder Plus: 3.0, 2.0, 1.5, 1.2, 1.031, 0.9, 0.8, 0.7, 0.6, 0.5, 0.4, 0.3, 0.2, 0.1 kb). Az RT-PCR-b l származó fragmentum szekvencia információjából kiindulva 5' és 3' RACE-el egy 3073 bp-nyi szekvenciát izoláltunk zöld gyümölcsb l származó templáton. Ebb l 2535 bp kódolja az ORF-et, 538 bp pedig a 3' UTR-t képviseli. A teljes hosszúságú gén nukleotid szinten az alma (Malus domestica L.) CTR1-el (AY670703) 90%-os, valamint a körte (Pyrus communis L.) CTR1 génnel (AF386508) pedig 88%-os homológiát mutat. A FaCTR1 (AY538771) fehérje szinten a legnagyobb homológiát (90%) a rózsa (Rosa hybrida) CTR1-el (AAK40361), valamint egy paradicsom CTR1-szer fehérjével (LeCTR3) (AAR89823) (67%) mutatja. A. LeCTR3 MEMS--TRRSNYTLLSQVADDNYLPPPPKYSVTGGGGGGGGVAPYYESHSGEKGKGKTGD 58 LeCTR4 MEVP--VRRSNYAILQQQP PYDEFNSDEKSKSR-GD 33 FaCTR1 MEMITTTRRSNYTLLSQVPDDQF TATSFYEGEGKNNNNNNNNKAK-VD 47 AAK40361 MEMP--GRRSNYTLLSQVPDDHFAA ATATSFYESEGKN----NNNKAK-GD 44 AtCTR1 MEMP--GRRSNYTLLSQFSDDQVSVSVT--GAPPPHYDSLSSENRSNHNSGNTGKAK-AE 55 XP_ MKAD--AKWPAMVLGGGGGGGRRASPGS APPPAAPAAVAYSLLATSPPASIGN 51 PcCTR LeCTR3 NRGFDWDL---SDHRSNMMQASNRIGAAAFPGSIGLQRQSSGSSFGESSISGEYYMPSLS 115 LeCTR4 -KGLYWDL---IDRRK GTTPFQASIVLPTQSSEGSFAESSISG FaCTR1 GRGFDWET-GGGGYRAANNPPSNRIGN--VFLSVGLQRQSSGSSFGESSLSGEYYAPTLS 104 AAK40361 SRGFDWET-GGGEYRAA---PANRIGN--VYSSVGLQRQSSGSSFGESSLSGEYYAPTLS 98 AtCTR1 RGGFDWDPSGGGGGDHRLNNQPNRVGNNMYASSLGLQRQSSGSSFGESSLSGDYYMPTLS 115

42 42 Eredmények és megvitatásuk XP_ GGGSPHCDDGDASRGLG VADWLRLQRHSSGSSAGDD---GDGFS PcCTR LeCTR3 ----NAEASFGYLNDGG GGAEVRMKPLEANLFGGSSS-KSWAQQTEESY 159 LeCTR VSFGYMN AYSDVGGSLS-KSWAQQTEESY 100 FaCTR1 TMAANEIDGFGYVNDEG FRGKIG--MDETXVGPTGXSSFGKSWAQQTEESY 153 AAK40361 TTAANEIDGFGYVNDDGFKTGGGGGEFRGKGG--GMDGGVGPPGGSSSGKSWAQQTEESY 156 AtCTR1 -AAANEIESVGFPQDDGFRLG-----FGGGGGDLRIQMAADSAGGSSSGKSWAQQTEESY 169 XP_ SVSTLATADKGG DPADRPAGSSGGGGS-KSWAQQAEEAY 130 PcCTR DVQYLTGHVDERK 13 LeCTR3 QLQLALALRLSSEATCADDPNFLDHVPDESASRASASAASAETLSHRFWVNGCLSYFDKV 219 LeCTR4 QLQLTLALRISTEATCADDPNLLDYVPDESVSHASASSASVEAMSHRFWVNGSLSYFDKV 160 FaCTR1 QLQLALALRLSSEATCADDPNFLDPVPDESWSRLS---SSADAVSHRFWVNGCLSYFDKV 210 AAK40361 QLQLALALRLSSEATCADDPNFLDPVPDESSSRLS---SSADAVSHRFWVNGCLSYFDKV 213 AtCTR1 QLQLALALRLSSEATCADDPNFLDPVPDESALRTSP--SSAETVSHRFWVNGCLSYYDKV 227 XP_ QLQLALALRLCSEASTAPDPNFLDSAVAAADDHHRD-APSPQSLSHRFWVNGSLSYSDKV 189 PcCTR1 PPQLADFLN WFLHDKKGTSTLSKP---SSTGHRPHHVRVTGRLS LeCTR3 PDGFYLIHGMDPYVWIVCSDLQENARVPSIESMRAVDPSVVPSVEVILIDRRTDPSLKEL 279 LeCTR4 PDGFYFIQGMDPYIWTVCSDLQESGRIPSIESLMAVDPSVVPSVEVILIDRQSDPRLKEL 220 FaCTR1 PDGFYLIHGIDSYVWSMCTDVQESGRIPSIESLRSIDPGTGSSIEVILIDRCSDPSLKEL 270 AAK40361 PDGFYLIHGIDSYVWSMCTDVQESGRIPSIESLKSVDPGTGSSIEVVLIDRRSDPSLKEL 273 AtCTR1 PDGFYMMNGLDPYIWTLCIDLHESGRIPSIESLRAVDSGVDSSLEAIIVDRRSDPAFKEL 287 XP_ LDGFYLIHGMDPFVWTLCNDLRDGARVPSIESLKAMNP-TESSVEVVLIDRVVDYDLRQL 248 PcCTR TSCHLVDEDRELLLPRRHHNDDDHDNHVSSIFIDQS LeCTR3 QNRIHSLSPTCGTTKEVVDQLAQLVCSHMGG-ATSAGEDELVPLWKECSYELKDCLGSTV 338 LeCTR4 QNRIHSMYRSCNTTKEVVDQLAKLVCNHMGG-AASVGEGDFIPIWKECCNDLKDCLGCFV 279 FaCTR1 QNRVLSISCACITTTEIVDQLAKLVCSRMGG-SASVGEADFFPIWRESSDELKDCLGSVV 329 AAK40361 QNRVLSISYACITTTEIVDQLAKLVCSRMGG-SASVGEAEFFSIWRESSDDLKDCLGSVV 332 AtCTR1 HNRVHDISCSCITTKEVVDQLAKLICNRMGG-PVIMGEDELVPMWKECIDGLKEIF-KVV 345 XP_ ISTAIDVSRSRADSREITTRLAGIVSSKMGGSVASTEEHELCPRWRDSAGFLKISSGSVV 308 PcCTR LTDGGEGG QIIKETS L 106 LeCTR3 LPIGSLSVGLCRHRALLFKVLADAIGLPCRIAKGCKYCNRADASSCLVRFGPDREYLVDL 398 LeCTR4 FPIGSLSVGLCRHRTLLFKVLADIIDLPCRIARGCKYCKESDAFSCLVRFGLDREYLVDL 339 FaCTR1 VPIGSLSIGLCRHRALLFKVLADTIDLPCRIAKGCKYCTRDDASSCLVRFGVDRELFVDL 389 AAK40361 VPIGSLSIGLCRHRALLFKVLADTIDLPCRIAKGCKYCTRDDASSCLVRFGIDRELLVDL 392 AtCTR1 VPIGSLSVGLCRHRALLFKVLADIIDLPCRIAKGCKYCNRDDAASCLVRFGLDREYLVDL 405 XP_ LPIGKLSIGLCRHRSLLFKTLADTISLPCRVVRGCRYCKSAGAASCLVHFGNDREYLIDL 368 PcCTR1 LPGDQTRFGLESS---LMRLELKGNSPHCLVQSDIPPCVQGDASEALDVTATAVASLEEC 163 LeCTR3 IGSPGCLCEPDSSLNGPSSISISSPLRFPRFREVEPTTDFRSLAKQYFSDCQSLNLVFEE 458 LeCTR4 IRDPGCLYEPNSLLNGPSSISIPSPLRLPRFGQVEPAMDFTSFAKQYFSDCLSLNLAFDD 399 FaCTR1 IGNPGCLCEPDSLLNGPSTISISSPLRFPRIRTVEPTIDFRTLAKQYFSDCQLLNLVFDE 449 AAK40361 IGNPGCLCEPDSLLNGPSSISISSPLRFPRLRTVEPTIDFRSLAKQYFSDCQLLNLVFDE 452 AtCTR1 VGKPGHLWEPDSLLNGPSSISISSPLRFPRPKPVEPAVDFRLLAKQYFSDSQSLNLVFDP 465 XP_ IGNPGFLSEPDSLLNGLSSISVSSPLRPPKYNSADIVNNFKSLAKQYFLDCQSLNMMFND 428 PcCTR1 AR----LSEENDVVQQAYRKEIVVSRNQVIRNSVEQPK--VTLYNQSDLEGVHSELVK LeCTR3 SSAGAAVDGDAGQTDRNNIERNSAVTG---PSNRDEVSRLPVPAI LeCTR4 SSAGTAVDGDAGQTDRSSMDKSSAVPS---SSNRDEVSRLPLPSINAWNKGCDKGSQLPA 456 FaCTR1 APAGSAGNEDNKGFSMYPKQKFTDGNNLFLDSSLDDDTSMHVDDRSPQLLKSYNPSQ AAK40361 APAGSAGDEDNKGFSMYPKQKFTDGNNLFLVSGLGDDTSMHVDDRNPQFLKSFNPSQ AtCTR1 AS DDMGFSMFHRQYDNPG GENDALAENGGG-----SLPPSA XP_ PAAVSGTVVDLDEAMGSNIGPNLSPAT-----NSDFQANFSHRS PcCTR QGRITAVTN LeCTR RDMAPVKYVRPVLHGDTQLSDP----RDIGNDMRFLERGSQLVPSK 542 LeCTR4 KYHPPNMSISMSQEKDLIHLKNVPPIRYVDAHLIAISEARTDTINDQRYFEGVGRLAPAK 516 FaCTR NIVHQQTMLKDQIPLKRIPPIGHRDISRLDT SRDSRSGEGLQVVPSK 553 AAK NIVHQQTVLKDQIPLKRIPPIGHRDISRLDT SKDSRFGEGLQVVPSK 556 AtCTR NMPPQN-MMRASNQIEAAP-MNAPPIS QPVPNR 532 XP_ RGAQSSGQDGNFLIQKSSPEDT QSAQSD 495 PcCTR PRY 227

43 43 Eredmények és megvitatásuk LeCTR3 ISRDIALEIEDFDIPWEDLVLKERIGAGSFGTVHRADWNGSDVAVKILMEQDFHAERFKE 602 LeCTR4 PSRGLVLDVEDLDIPWNDLVLKERIGAGSFGTVHRADWNGSDVAVKILMEQDFHAERYKE 576 FaCTR1 PNKELTFDVDDLDIPWSELALKERIGAGSFGTVHRADWHGSDVAVKILMEQEFMLNALKS 613 AAK40361 PNKELTLDVDDLDIPWSDLVLKERIGAGSFGTVHRADWHGSDVAVKILMEQEFHAERFNE 616 AtCTR1 ANRELGLDGDDMDIPWCDLNIKEKIGAGSFGTVHRAEWHGSDVAVKILMEQDFHAERVNE 592 XP_ PFSDISLDIEDLIIPWSELVLKEKIGAGSFGTVHRADWNGSDVAVKILMEQDFHPERLKE 555 PcCTR1 LNLEPTLAMDWLEISWDELNIKERVGAGSFGTVHRAEWNGSDVAVKVLTVQDFHDDQLKD 287 LeCTR3 FLREVAIMKRLRHPNIVLFMGAVTQRPNLSIVTEYLSRGSLYRLLHKPGAREVLDERRRL 662 LeCTR4 FLQEVAIMKRLRHPNIVLFMGAVTEPPNLSIVTEYLSRGSLYRLLHKPGAREVLDEKRRL 636 FaCTR1 SLGEVTIMKRLRHPNIVLFMGAVTKPPNLSIVTEYLSRGSLYRLLHKPGP--VLDERRRL 671 AAK40361 FLREVAIMKRLRHPNIVLFMGAVTKPPNLSIVTEYLSRGSLYRLLHKPGP--ILDERRRL 674 AtCTR1 FLREVAIMKRLRHPNIVLFMGAVTQPPNLSIVTEYLSRGSLYRLLHKSGAREQLDERRRL 652 XP_ FLREVAIMKSLRHPNIVLFMGAVTQPPKLSIVTEYLSRGSLYRILHKHGARENLDEKRRL 615 PcCTR1 FLREVAIMKRVLHPNVVLFMGAVTKRPHLSIVTEYLPRGSLYRLIHRPASGELLDQRRRL 347 LeCTR3 SMAYDVAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAA 722 LeCTR4 CMAYDVAKGMNYLHKRKPPVVHRDLKSPNLLVDTKYTVKVCDFGLSRLKANTFLSSKSAA 696 FaCTR1 NMAHDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAA 731 AAK40361 YMAHDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAA 734 AtCTR1 SMAYDVAKGMNYLHNRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKASTFLSSKSAA 712 XP_ SMAFDVAKGMNYLHKRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKTAA 675 PcCTR1 RLALDVAKGINYLHCLNPPIVHWDLKSPNLLVDKNWTAKVCDFGLSRFKANTFISSKSVA 407 LeCTR3 GTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWSNLNPAQVVAAVGFKGKRLDI 782 LeCTR4 GTPEWMAPEVLRDEPSNEKSDIYSFGVILWELATLQQPWSNLNPPQVVAAVGFKGMRLEI 756 FaCTR1 GTPEWMAPEVLRDEPPNEKSDVYSFGVMLWELATLQQPWGNLNPAQVVAAVGFQNKRLEI 791 AAK40361 GTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKNKRLEI 794 AtCTR1 GTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKCKRLEI 772 XP_ GTPEWMAPEVIRDEPSNEKSDVYSFGVILWELMTLQQPWSTLNPAQVVAAVGFNGRRLEI 735 PcCTR1 GTPEWMAPEFLRGEPSNEKSDVYSFGVILWELATMQQPWGNLNPAQVVAAVGFKNKRLEI 467 LeCTR3 PRDLTPQVASIIEACWAKEPWKRPSFAAIMDMLRPLIKPPVTPPQPGRTDTQLIA 837 LeCTR4 PRDLNHPVTTIIEACWVNEPWKRPSFSTIMDMLKPLI FaCTR1 PRDVNPQVASIIEACWANEPWKRPSFASIMESLKPLIKAPTPQPSHADLPILT AAK40361 PRDLNPQVASIIEACWANEPWKRPSFASIMESLRPLIKAPTPQPSHADMPILT AtCTR1 PRNLNPQVAAIIEGCWTNEPWKRPSFATIMDLLRPLIKSAVPPPNRSDL XP_ PSSVDPKVAAIMESCWTKEPWRRPSFASIMESLKPLIRTPHQLQEDIS PcCTR1 PRDLNPNVAAIIEACWANEPWKRPSFAVIMDSLTPLIKAPVTQPSRADMPLLT B. 15. ábra. A FaCTR1 (Fragaria x ananassa, AAT07466) és néhány CTR1 fehérje, AAK40361: CTR1-szer protein kináz (Rosa hybrida), LeCTR3 és LeCTR4 (Lycopersicon esculentum, AAR89823 és AAR89822), XP_ feltételezett CTR1-szer protein kináz (Oryza sativa), PcCTR1 (Pyrus communis, AAL66190), AtCTR1 (Arabidopsis thaliana, NP_850760), aminosavszekvenciáinak összehasonlítása a ClustalW programmal. A.: Fehérjeösszehasonlítás. A szürke háttérben bekeretezett aminosavak a konzervált ATP-köt helyet (IGAGSFGTVH) és a szerin/treonin kinázok konzervált doménjét jelölik (IVHRDLKSPNLLV). A szürke háttérben, egy vonallal jelzett aminosavak a CN box-ot képviselik (Huang et al. 2003), a nyíl alatti szekvencia EC (etilén CTR-specifikus) domén (Adams-Phillips et al. 2004). B.: A rokonsági viszonyt ábrázoló kladogram.

44 44 Eredmények és megvitatásuk A FaCTR1 fehérje rendelkezik a szerin/treonin protein kinázok valamennyi jellegzetes tulajdonságával, így megtalálható a valamennyi kinázra jellemz ATP-köt hely (IGAGSFGTVH) (Schenk és Snaar-Jagalska, 1999) és a Ser/Thr kinázokra (mint a Raf és AtCTR1) jellemz aktív centrum (IVHWDLKSPN) (Kieber et al. 1993). A FaCTR1-ben jelen van az AtCTR1 és más CTR fehérjék N-terminális végében azonosított CN-box, egy fehérjefehérje kölcsönhatást biztosító motívum, és a CTR1-ETR1 interakcióért felel s (Huang et al. 2003). A CN-box mögött jelen van egy másik konzervált domén, az EC (etilén CTRspecifikus), ami valószín leg csak a CTR1-szer szekvenciák jellemz je (Adams-Phillips et al. 2004) (15. ábra. A). A filogenetikai analízisb l kit nik, hogy a FaCTR1 (a FaACS és FaACO-hoz hasonlóan) ismét egy Rosaceae családba tartozó CTR1-szer fehérjével (AAK40361) mutatja a legközelebbi rokonságot. A körte CTR1 valószín leg a részleges szekvencia miatt nem került ebbe a csoportba, hanem jóval távolabb, egy rizs CTR1-el (XP_466052) közösen alkotnak egy klasztert (15. ábra. B). Az etilén jelátviteli út downstream elemeinek transzkripciós szabályozásáról kevés kísérleti adattal rendelkezünk. Az Arabidopsis CTR1 expressziója konstitutív, és etilénnel nem indukálható (Kieber et al. 1993, Gao et al. 2003), szemben az LeCTR1-el, ami etilénnel indukálható fiatal gyümölcsben és levélben (Adams-Phillips et al. 2004). Az RT-PCR eredmény alapján a FaCTR1 konstitutív expressziót mutat gyümölcséréskor és vegetatív szövettípusokban egyaránt A FaCTR1 promoter izolálása, bioinformatikai elemzése A TAIL-PCR-el felszaporított CTR1 promoter régió hossza 1590 bp. A PLANTCARE és PLACE adatbázisok segítségével azonosított szabályozó elemek közül említésre méltó motivumokat a 12. táblázat tartalmazza. A szamóca és Arabidopsis CTR1 (AT5G03730) promotereinek szekvenciaszint összehasonlításakor sok, azonos felépítés és feltételezetten hasonló funkciót ellátó motívumot azonosítottunk (16. ábra). A FaCTR1 promoterében egyszer, az AtCTR1 promoterben, közvetlenül egymás mellett kétszer fordul el a (GA) 8 ismétl dés (-189 pozícióban), és jelen van egy (GA) 4 elem is (-120 pozícióban). A (GA) 8 ismétl dés gyakori a növényi genomokban, különösképp jellemz a növényi promoterekre (Santi et al. 2003). GA/TC ismétl dés - köt proteinek Drosophila-ban GAGA vagy GAF fehérjékként

45 45 Eredmények és megvitatásuk ismertek (Soeller et al. 1993). A Drosophila GAF néhány homeotikus gén expressziójáért felel s, kölcsönhatásba lép h sokk és hiszton gének promoterével (Soeller et al. 1988). 12. táblázat. A FaCTR1 promoterében azonosított szabályozó régiók szekvenciája, szerepük, el fordulásuk száma és helye Motívum szekvenciája Szerepe El fordulásának száma és helye Szerz k GAAAAA Patogén és só indukálta stresszválasz 3, -104, -207, -278 Park et al TCTCTCTC Enhancer, nukleáris fehérjékkel történ 2, -140, -130 Pauli et al interakció CCAAT H stressz 4, -232, -341, -384, Haralampidis et al TTGACC Elicitor 1, -298 Eulgem et al (GA/TC) 8 Homeodomén gének szabályozó eleme 1, -524 Santi et al CCGAAA Hidegstressz 2, -240, -322 Dunn et al AGCAGC Anaerob stressz 1, -479 Mohanty et al TGTCACA Enhancer 1, -721 Yamagata et al CAANNNNATC Cirkadián ritmus 1, Piechulla et al ACGTG Dehidratáció és sötétség Simpson et al. 1, indukálta szeneszcencia 2003 TAACAA Giberellin válasz 1, -410 Ogawa et al CTCTT Feltételezetten a Stougaard et al. 2, -1225,-997 nodulációban van szerepe 1990 A homeotikus gének elcsendesítésében szerepet játszó polycomb válasz elemei szintén tartalmaznak GAF köt GA ismétl déseket (Busturia et al. 2001). Növényekben a (GA/TC) 8 ismétl dések funkciójáról kevés adat van. Arabidopsis-ban az ismétl dés több homeodomén gén promoterében is jelen van. Árpában, a BKn3 gén expressziójának szabályozása a BBR (barley b recombinant) fehérjének a gén promoterében és intronjában lev (GA/TC) 8 ismétl désekhez való köt dése által történik (Santi et al. 2003). A BKn3 a homeobox gének csoportjába tartozik és a merisztémák fenntartásában és levélkezdemények kialakulásában játszik szerepet (Santi et al. 2003). Mindkét promoterben jelen vannak a különböz stresszválaszban szerepet játszó szabályozó motívumok, ilyenek például a patogén, só, h, dehidratáció és sötétség indukálta szeneszcenciában, valamint anaerobiózis során fellép stresszválaszokban résztvev elemek.

46 46 Eredmények és megvitatásuk FaACS AtACS6 AtACS2 LeACS7 FaCTR AtCTR1 5' I I I I I 3' 2000 bp 1500 bp 1000 bp 500 bp 0 bp GAAAAA - patogén és sóstressz (GA)8 CCAAT- h stressz TGTCTC - auxin válasz CAACTG - szárazságstressz CAANNNCATC-cirkadian ritmus TTTGACT- sebzés TGGTTT- anaerobiózis ACGTG - Dehidratáció és sötétség indukálta szeneszcencia TAACAA - giberellin válasz TTTCAAA - fényindukálhatóság 16. ábra. A FaACS, AtACS6, AtACS2, LeACS7, FaCTR1 és AtCTR1 promoterekben megtalálható feltételezett cisz elemek.

47 47 Eredmények és megvitatásuk CTR1 promoterek funkcionális elemzésével kapcsolatos irodalmi adattal nem rendelkezünk, így a szabályozó elemek jelenléte csak elméleti síkon utalhat a gén transzkripciós szint szabályozás mechanizmusára. Bár a FaACS és FaCTR1 expressziós mintázata eltér (a gyümölcsben a FaCTR1 konstitutív expressziót mutat, a FaACS expressziója differenciált), mivel a két gén azonos biológiai folyamat résztvev je, közös szabályozó elemek azonosítása céljából összehasonlítottuk a két promoter régiót. Érdekes megfigyelés, hogy FaACS és FaCTR1 promoterekben egyaránt azonosítható volt a cirkadián szabályozásáért felel s elem (CAANNNCATC), ami ugyanakkor nem volt megtalálható az Arabidopsis CTR1 promoterben. A stresszválaszokat befolyásoló szabályozó elemek közül mindkét promoterben jelen van a dehidratáció és sötétség indukálta szeneszcencia szabályozásáért és anaerobiózis indukcióért felel s elemek (mindkett jelen van az AtCTR1 promoterben is) (16. ábra). Nem elhanyagolható szempont viszont, a két promoter méretbeli különbsége (a FaACS promoter 1024 bp, a FaCTR1 promoter régió hossza 1590 bp), ami megnehezíti a reális összehasonlítást. Mindkét gén (FaACS és FaCTR1) esetében folyamatban van a promoter további 5' részének izolálása.

48 48 Eredmények és megvitatásuk 4.4. A gyümölcsérés során gátolt és indukált gének azonosítása cdns-aflp-vel A szamóca és ezáltal a nem utóér gyümölcsök érési mechanizmusának feltárása érdekében a cdns-aflp technika módosított változatát (Breyne et al. 2003) használtuk gyümölcs specifikus és érésindukálta gének azonosítása céljából. Ez a cdns-aflp verzió globális, kvantitatív genexpressziós analízisre alkalmas (Breyne et al. 2003). A cdns-aflp segítségével ritka mrns-ek detektálhatók, a technika lehet vé teszi a gyümölcsfejl désben és érésben szerepet játszó új gének azonosítását is. A cdns-aflp géleken 1403 fragmentumot összegeztünk. Az AFLP-QuantarPro adatok normalizálása után 290 olyan differenciáltan experesszálódó TDF-t találtunk, amelyek CV értéke >1. A hierarchikus klaszterelemzés után (Eisen et al. 1998), a 290 differenciáltan expresszálódó gének három nagy csoportot alkottak (17. ábra), a legnagyobb csoportba a 120 aszmag specifikus fragmentum tömörül, a többi transzkriptum a zöld gyümölcshúsban (86 TDF) valamint az érés során akkumulálódik (84 TDF). Az expressziós mintázatuk, valamint a sávok izolálásra való alkalmasságuk alapján (méret, élesség) 130 TDF-et izoláltunk majd szekvenáltunk. Ezeknek a szekvenciáknak 36%-a gyümölcshús és érés specifikus, 30%-uk a zöld gyümölcsre jellemz, tehát expressziójuk az érés el rehaladtával gátlódik, és a TDF-ek 34%-a aszmag specifikus. A BLAST keresés eredménye alapján valamennyi TDF-et funkcionális kategóriákba soroltuk. A szekvenált TDF-ek többsége (34% az érett gyümölcsben, 47% a zöld gyümölcsben és 50% az aszmagban expresszálódó gének közül) nem mutatott ismert szekvenciákkal homológiát, vagy a homológia értéke alacsonyabb volt a megszabott küszöbértéknél (E < e-0,002) (13., 14., 15. táblázat) (Balogh et al. 2005a). Valamennyi E < e-0,002-vel rendelkez szekvenciát az NCBI GenBank adatbázisába leadtuk, azonosító számuk az 13., 14., és 15. táblázatban vannak feltüntetve. A táblázatokban feltüntetett homológiák csak öt esetben azonosak a GenBankba már leadott szamóca génekkel, és másik hét szekvencia hasonló a Rosaceae családba tartozó fajok génjeivel, ami azt mutatja, hogy az adatbázisokban kevés a szamóca génekre vonatkozó információ.

49 49 Eredmények és megvitatásuk Aszmagban expresszálódó gének Zöld gyümölcshúsban expresszálódó gének Érés során a gyümölcshúsban expresszálódó gének 17. ábra. A differenciáltan expresszált cdns-aflp transzkriptumok hierarchikus klasztere Cluster és TreeView programmal. Piros: génexpresszió, zöld: génexpresszió gátlás.

50 50 Eredmények és megvitatásuk A. B. % C. % 18. ábra. A cdns-aflp fragmentumok funkcionális csoportosítása. A: zöld gyümölcsben expresszálódó TDF-ek, B: az érés során expresszálódó TDF-ek, C: aszmag specifikus TDFek. %

51 51 Eredmények és megvitatásuk Zöld gyümölcsben expresszálódó gének funkcionális csoportosítása A 86 zöld receptákulumban jelen lev TDF közül 39-et szekvenáltunk. A szekvenciák majdnem fele (46%) nem mutatott semmilyen homológiát, míg 6 fragmentum (18%) valószín leg ismeretlen funkciójú fehérjéket kódol (18. ábra. A). Az azonosított fragmentumokat, a GenBank-i hivatkozási számokat valamint a szekvenciák homológiáját és funkcionális besorolását a 13. táblázatban foglaltuk össze. Expressziós mintázatuk alapján a zöld gyümölcsben jelen lev TDF-ek élesen elkülönülnek az érés indukálta gének csoportjától (17. ábra), ami összhangban van a zöld és érett gyümölcsökben lezajló, eltér fiziológiai és biokémiai folyamatokkal. Ebben a stádiumban (közepes méret zöld gyümölcs), az egyik meghatározó folyamat az auxin hatására történ sejtnagyobbodás és gyümölcsnövekedés. Két, sejtnövekedésben kulcsszerepet betölt, gént azonosítottunk. Az egyik, (C13M214M008), a szamóca ß-galaktozidázzal mutat homológiát (Faßgal3), sejtfal hidroláz, ami reverzibilis sejtfallazulást eredményez, a turgor alapú sejtnövekedést más sejtfalmódosító fehérjékkel közösen segíti el. Trainotti (2001) már bizonyította hogy a ß-galaktozidáz gén expressziója intenzív a virágban és a fiatal gyümölcsben, majd fokozatosan csökken a gyümölcs fejl dése és érése során, és szinte detektálhatatlanná válik a piros gyümölcsben. Szintén Trainotti (2001) számol be arról hogy a Faßgal3 expressziós mintázatával ellentétben a ß-galaktozidáz két másik izoformáját (Faßgal1 és Faßgal2) az érés indukálja, és a sejtfal szétesésében játszik szerepet. A sejtnövekedésért felel s másik gén a (C24M43M007) a transzport funkciót ellátó gének csoportjába tartozik és egy, az almából izolált MdPIP1 (BAD14371) plazma membrán fehérjét (vízcsatorna fehérjét) kódoló génnel homológ. A Faßgal3-al együtt a gyümölcs növekedése során a sejt expanzióért a víz homeosztázisának fenntartása révén lehet felel s (Hu et al. 2003). A hormon metabolizmus csoportját egy TDF, a feltételezett nitriláz-rokon fehérjét kódoló klón (C11M32M003) képviseli, a zöld gyümölcsben és aszmagban egyaránt jelen van, és a transzkriptum akkumulációja az érés során csökken. A génr l részletesebben a kés bbiekben számolunk be. A zöld gyümölcsben jelenlev, stressz indukálta transzkriptumok csoportja kisebb hányadot (7,7%) tesz ki, ide tartozik egy peroxidázt (C24M32M014), poligalakturonázt gátló fehérjét (C14M21M010) és egy ubiquitin specifikus proteáz 26-ot (C24M24M013) kódoló transzkriptum.

52 52 Eredmények és megvitatásuk 13. táblázat. A zöld gyümölcshúsból izolált transzkriptumpok és homológiájuk cdns-aflp fragmentum C11M32M003 GenBank hivatkozási szám AY Feltételezett azonosság Nitriláz szer fehérje Feltételezett funkció Hormon metabolizmus C11M32M009 AY Feltételezett citokróm P450 Ismeretlen C11M32M010 C11M33M010 AY AY Feltételezett mitokondriális szállító fehérje Feltételezett AAA-típusú ATPáz Szállítók és hordózók Els dleges anyagcsere C11M34M012 AY Kalretikulin 3 Jelátvitel C12M11M005 AY Mal d1 homológ (pruar1gc1) C12M11M006 C12M12M008 C13M214M003 AY AY AAX23999 BEL1-szer homeotikus fehérje 30 3-hidroxivajsav-dehidrogenázszer fehérje Klorofill a/b-köt CP24 prekurszor Ismeretlen Szabályozás DNS/RNS/ fehérje C13M214M008 AJ278705* Béta-galaktozidáz (beta-gal3) Sejtfal C14M12M015 AY Riboszomális fehérje S12 (rps12) Fotoszintézis Ismeretlen C14M13M002 AY RING finger fehérje Szabályozás C14M13M006 AY Ismeretlen fehérje Ismeretlen C14M21M010 AY Poligalakturonáz gátló fehérje Stressz C14M33M016 AY NADH-ubiquinon oxidoreduktáz rokon fehérje Els dleges metabolizmus C23M13M005 AY Citokróm P450 Ismeretlen C23M32M007 DQ Feltételezett fehérje Ismeretlen C24M14M002 C24M24M013 AY AY S-adenozil-Lmetionin:carboxil metiltranszferáz Ubiquitin specifikus proteáz 26 (UBP26) Prosztetikus csoport Stressz C24M32M014 AY Peroxidáz (Prx2b) Stressz Plazma membrán C24M43M007 DQ fehérje * Az NCBI adatbankjába már leadott szamóca gének Az aláhúzott TDF-ek teljes hosszúságú cdns-ét azonosítottuk Szállítók hordozók és Homológia azonosító száma, faj neve AAG52493 Arabidopsis NP_ Arabidopsis T00435 Arabidopsis AAO72381 Oryza sativa AY Brassica rapa AF Prunus armeniaca AAN03627 Solanum tuberosum AAM63893 Arabidopsis AAD27882 Vigna radiata AJ Fragaria ananassa AF Gunnera chilensis NP_ Arabidopsis BAB02057 Arabidopsis CAD56505 Cicer arietinum At5g52840 Arabidopsis AF Pyrus communis BAD38514 Oryza sativa NP_ Arabidopsis NP_ Arabidopsis AF Glycine max No hit E érték 1e-17 2e-14 1e-07 5e-17 8e-20 8e e-28 7e-75 2e-77 1e-05 2e-26 2e-07 7e-08 4e-04 4e-06 1e-04 4e-08 1e-13 6e-13 No hit A szignál transzdukció csoportot a kalretikulin 3 (C11M34M012) képviseli. Állati sejtekben a kalretikulin fontos szerepet tölt be a Ca 2+ szignálok összehangolásában (Camacho és Lechleiter, 1995). Rizsben a kalretikulin befolyásolhatja a sejtszuszpenziók

53 53 Eredmények és megvitatásuk regenerálóképességét, a Ca 2+ homeosztázis és jelátvitel szabályozása révén (Li és Komatsu, 2000). A kalretikulin akkumulációját a fitohormonok is befolyásolják (Borisjuk et al. 1998). Különböz formáiról bizonyították, hogy szövetspecifikus expressziós mintázatot mutatnak, amit stresszfaktorok is befolyásolnak (Persson et al. 2003). A szabályozásban szerepet játszó gének csoportját két klón képviseli: a C14M13M002 fragmentum egy RING-finger fehérjét, a C12M11M006 pedig egy BEL1-rokon homeotikus fehérjét kódol. Arabidopsis-ban a BEL1 a magkezdemény fejl déséért felel s az AGAMOUS gén gátlása révén (Ray et al. 1994). Ez utóbbi a MADS box gének csoportjába tartozik, és mint ilyen a vegetatív, virág és gyümölcsfejl dést szabályozzák. Az AGAMOUS homológját szamócában is azonosították (STAG1), transzkriptuma a term levelekben, porzókban és fiatal gyümölcsben volt detektálható (Rosin et al. 2003). Elképzelhet, hogy a szamóca BEL1 az Arabidosis-ban ismert szerepet tölti be és a STAG1 szabályozásában vesz részt Az érés során expresszálódó gének funkcionális csoportosítása Az érés által indukált transzkriptumok csoportját a fehér, rózsaszín és piros érési stádiumra jellemz gének alkotják, élesen elkülönülve a zöld gyümölcsben akkumulálódó gének átirataitól, expressziójuk tehát n az érés során. 47 TDF-et szekvenáltunk meg, ezek 34%-a nem vagy megbízhatatlan homológiát mutatott az adtabázisban szerepl génekkel, így ezekhez a szekvenciákhoz nem tudtunk funkciót hozzárendelni (18. ábra. B) (14. táblázat). A legnagyobb funkcionális csoportot a stressz válaszban résztvev gének képviselik. A szabadgyökök hatására bekövetkezett peroxidatív károsulás és a membrán integritásának elvesztése jellemz ek az öreged növényi szövetekre. A szeneszcenciához hasonlóan, a gyümölcsérést is a sejtmembránok károsulása kíséri (Ferrie et al. 1994). A szabadgyökök semlegesítésének csökkent képessége, és az ennek következtében növekv oxidatív stressz lehet azoknak a fizikai-kémiai változásoknak a háttere, amelyek el segítik a fanyarka (Amelanchier alnifolia Nutt.) gyümölcsérését (Rogiers et al. 1998). A sz l, egy másik nem klimaktérikus gyümölcs esetében, Davis és Robinson (2000) által közölt eredmények szintén igazolják az érés során, a stressz-válaszban szerepet játszó fehérjék akkumulációját. Aharoni et al. (2002) szerint az éréskor fellép oxidatív stressz válaszreakciója aktív génexpresszió, másrészt a szamóca érésének transzkripciós programja oxidatív stressz-indukálta folyamat. Kísérletünk során több, valószín leg oxidatív stressz hatására indukálódó gént is azonosítottunk. A rézvirág TED2 génjével (quinon oxidoreduktáz homológ) homológ (C24M13M007) szamóca génr l már bizonyították, hogy az érés és oxidatív stressz hatására

54 54 Eredmények és megvitatásuk aktiválódik (Aharoni et al. 2002), eredményeink szerint a transzkriptum akkumulálódása a rózsaszín stádiumban a legnagyobb és csökken az érett gyümölcsben. A C23M11M001 és C23M43M008 jelzés TDF-ek egy fitokelatin szintetázzal illetve egy feltételezhet en glutation S-transzferázzal mutatnak homológiát, mindkét génr l ismert, hogy éréskor indukálódik. A növények szintetizálnak olyan Cys-gazdag peptideket mint a glutation, fitokelatinok vagy metallotioneinek, a nehézfémek detoxifikációja vagy homeosztázisa céljából (Cobbett, 2000). Ennek a peptid csoportnak számos tagját gyümölcsérés során is kimutatták, például az almában (Reid és Ross, 1997), banánban (Clendennen és May, 1997), szamócában (Aharoni és O Connell, 2002) és ananászban (Moyle et al. 2005). Valószín leg az érési folyamatokat kísér oxidatív stressz válaszban, valamint a szabadgyökök detoxifikálásában van szerepük. 14. táblázat. Az érés során expresszálódó transzkriptumok és homológiájuk cdns-aflp fragmentum C11M33M001 C11M33M011 GenBank hivatkozási szám AY AY Feltételezett azonosság Aminosav transzport fehérje AAP1 Feltételezett GTP-köt fehérje (DRG) C11M33M013 AY Glikozil transzferáz család 47 Feltételezett funkció Szállítók hordózók Jelátvitel Prosztetikus csoport C11M33M014 AY Foszfolipáz PLDb2 Stressz C11M34M005 AY Transzláció iniciáló faktor DNS/RNS/ fehérje C12M11M011 DQ LEA4-25 Stressz C12M12M024 C13M214M007 AY DQ U3 snornp-szer fehérje Alkohol dehidrogenáz homológ, érés specifikus DNS/RNS/ fehérje Íz-illatanyag C14M21M006 AY Receptorszer fehérje kináz Jelátvitel C14M31M010 AF * Pektát liáz B Sejtfal bomlás C14M33M006 AY Szedoheptulóz-1,7-bifoszfatáz prekurszor és Els dleges metabolizmus C23M11M001 AY Fitokelatin szintetáz Stressz C23M12M001 DQ Feltételezett stressz-válasz fehérje Stressz C23M21M001 AY Kináz 2 Jelátvitel Homológia azonosító száma, faj neve T10100 Ricinus communis BAC79856 Oryza sativa NP_ Arabidopsis AAG45488 Lycopersicon esculentum AF Pisum sativum AAC49862 Phaseolus vulgaris At4g05410 Arabidopsis S39508 Lycopersicon esculentum AAM62629 Arabidopsis AF Fragaria ananassa AY Oryza sativa BAB10641 Arabidopsis AAT01418 Tamarix androssowii AAA34017 Glycine max E érték 5e-64 7e-13 3e-05 7e-30 3e-40 3e-12 3e-13 5e-13 1e-12 2e-49 7e-65 4e-34 7e-15

55 55 Eredmények és megvitatásuk C23M21M011 DQ Feltételezett D-glükanáz endo-1,3;1,4- - C23M24M006 AY S riboszomális RNS gén C23M31M001 AY Feltételezett integráz Sejtfal DNS/RNS/ fehérje DNS/RNS/ fehérje C23M33M002 AY Flavonon-3-hidroxiláz Flavonoid út C23M33M014 AY Feltételezett 3b splicing faktor C23M42M006 AY AAA-típusú ATPáz C23M43M001 C23M43M008 C24M13M007 AY AAW82451 AY Sebzés indukálta P450 hidroxiláz Glutation S-transzferáz Quinon oxidoreduktáz homológ C24M14M001 AY Feltételezett beta-coat fehérje C24M14M007 DQ Spermidin szintáz C24M31M004 AAX09335 Feltételezett foszfatidilinozit glikán DNS/RNS/ fehérje Els dleges metabolizmus Stressz Stressz Stressz Szállítók és hordózók Poliamin metabolizmus Sejtfal C24M33M004 AY bhlh fehérje (SPATULA) Szabályozás C24M33M008 AY * UDP-glükózil transzferáz Szénhidrát anyagcsere C24M33M010 AY Kináz Jelátvitel C24M44M001 AY Glikozil transzferáz Prosztetikus csoport C24M44M003 AY Feltételezett HD-zip fehérje Szabályozás * Az NCBI adtabankjába már leadott szamóca gének Az aláhúzott TDF-ek teljes hosszúságú cdns-ét azonosítottuk AAU10802 Oryza sativa AF Vitis riparia AAD04177 Oryza sativa AB Malus x domestica BAD10377 Oryza sativa NP_ Arabidopsis AAG09208 Pisum sativum Q03666 Nicotiana tabacum T11672 Vigna sinensis NP_ Orysa sativa AB Malus x domestica NP_ Arabidopsis NP_ Arabidopsis AY Fragaria ananassa NP_ Arabidopsis NP_ Arabidopsis AAT39931 Solanum demissum 1e-15 1e-27 1e-38 3e-43 7e-11 e-119 2e-19 2e-30 4e-07 2e e-45 2e-40 1e-05 4e A C11M33M014 fragmentum egy foszfolipáz D-t kódol, ami a strukturális foszfolipidek hidrolízisét katalizálja, foszfatid savat és a f funkcionális csoportot szabadítva fel. Növényekben a poszfolipázok fokozott aktivitást mutatnak patogénekkel szembeni válaszreakciókban (Van der Luit et al. 2000), szárazság és oxidatív stressz hatására (Munnik et al. 2000), etilén és ABA hatására (Fan et al. 1997, Frank et al. 2000). Régebben a foszfolipázt katabolikus enzimként tartották számon, aktivitását csírázással, éréssel és szeneszcenciával hozták összefüggésbe (Munnik et al. 1998). Ezek az adatok azt mutatják, hogy növényekben a foszfolipáz D különböz funkciókat tölt be. Kísérletünkben a foszfolipáz D érés specifikus, leger sebben az érett gyümölcsben expresszálódik. Az érés során indukálódó és stresszválaszban szerepet játszó gének csoportjához tartozik még egy sebzés indukálta P450 hidroxilázzal homológiát mutató fragmentum (C23M43M001), valamint egy stresszválaszban indukálódó fehérjével hasonlóságot mutató fragmentum (C23M12M001) is.

56 56 Eredmények és megvitatásuk Külön funkciós csoportot képviselnek a különböz jelátviteli utak résztvev it kódoló gének transzkriptumai. Három kinázt kódoló TDF mutat érés specifikus expressziót (C14M21M006, C23M21M001, C24M33M010). Ezek közül a C23M21M001 klón egy szójából izolált fehérje kináz 2-vel (AAA34017) és egy rizs SAPK3 szerin/ treonin fehérje kinázzal (BAD17999) mutat homológiát. Az utóbbi a SnRK2 család tagja és hiperozmótikus stressz aktiválja, az SnRK2 család néhány tagja abszcizinsavval is indukálható (Kobayashi et al. 2004). A kináz 2 génnel együtt a további két receptorszer fehérje kinázt (C14M21M006, C24M33M010) kódoló gének az érést kísér stressz által indukált jelátviteli útvonalak részei lehetnek. Az utóbbi két receptorszer kinázról a kés bbiek folyamán részletesen lesz szó. A szabályozásban résztvev gének csoportját két transzkriptum képviseli. A C24M33M004 TDF egy Arabidopsis bhlh fehérjék csoportjába tartozó SPATULA-val mutat homológiát (NP_568010), ami többek között a term levelek kialakulásáért felel s (Heisler et al. 2001). A C24M44M003 fragmentum egy Solanum demissum-ból izolált feltételezett homeodomén-leucin cipzár (HDZip) kódoló génnel (AAT39931) mutat homológiát. A HDZip fehérjék a növényekre jellemz transzkripciós faktorok népes csoportját képezik, az eddig azonosított funkciójú gének a növény fejl désében vesznek részt (Hanson et al. 2002). Mindét klónról részletesebben beszámolunk a kés bbiekben. A sejtfalbomlásban szerepet játszó gének csoportját két TDF képviseli (C14M31M010 és C23M21M011), ezek egy pektát liázt és egy rizs homológ (AAU10802), feltételezett endo- 1,3;1,4- -D-glükanázt kódolnak. Az érést a gyümölcsök puhulása és a sejtfal szerkezetének szétesése kíséri, ami néhány enzimcsalád aktiválódásának a következménye. Mindkét génr l bizonyították az éréssel kapcsolatos sejtfalbomlásban betöltött szerepét. A pektát liáz akkumulációja szignifikáns az érett receptákulumban, ugyanakkor az auxin er sen gátolja a pektát liáz és endo-1,4- -glükanáz expresszióját is (Aharoni et al. 2002, Aharoni és O Connell, 2002, Benítez-Burraco et al. 2003,). A glükanáz gén transzkriptuma jelen van a zöld gyümölcsben, majd expressziója gátlódik, de az érett gyümölcsben ismét kifejez dik. Bár az 1,3;1,4- -D-glükanázt kódoló cdns-aflp fragmentum nem azonos az eddig azonosított szamóca glükanáz génekkel (Trainotti et al. 1999, Llop-Tous et al. 1999) ahhoz, hogy biztosak legyünk abban, hogy a glükanáz géncsalád új tagját izoláltuk, a teljes hosszúságú cdns klónozása szükséges. A két ismert glükanáz gén, a FaEG1 és a FaEG3 az érés során expresszálódik, de a FaEG3 transzkriptuma jelen van nagy zöld gyümölcsben és fiatal vegetatív szövetekben (Trainotti et al. 1999, Spolaore et al. 2003). Nincs adat a két glükanáz esetleges etilén-függ szabályozásáról. Az adatbázisban megtalálható FaEG1 és FaEG3 promotereinek bioinformatikai elemzése során etilén válaszért felel s motívumot

57 57 Eredmények és megvitatásuk azonosítottunk (ATTTCAAA), amely azonos a szegf etilén indukálta glutation-s-transzferáz promoterében behatárolt cisz-elemmel (Itzhaki et al. 1994), és amely jelenléte azt sejteti, hogy a szamóca glükanázok expresszióját, és ezáltal az érési folyamat során bekövetkez sejtfalbomlást befolyásolhatja az etilén. Egy másik, érésindukálta transzkriptum (C24M31M004) egy feltételezett foszfatidilinozit glikán-t kódol (PIG) (S osztály), expressziója a rózsaszín és érett gyümölcsben a legkifejezettebb. A PIG gén a glikozilfoszfatidilinozit (GPI) horgony bioszintézisében vesz részt. A GAP fehérjék (GPIanchored proteins) különböz fiziológiai folyamatokban vesznek részt, mint például a gyökérfejl dés, a sejtfal integritás és adhézió kialakulása és fenntartása. Arabidopsis-ban 248 GAP-ot azonosítottak, többek között olyan sejtfalbontó enzimek melyek az érés során is szintetizálódnak mint például -1,3 glükanázok, poligalakturonázok és pektát liázok (Borner et al. 2003). A szamóca érésekor a foszfatidilinozit glikán felel s lehet a sejtfal dinamikus átrendez déséért, szerkezetének megváltozásáért Az aszmagban expresszálódó gének funkcionális csoportosítása Kísérletünkben az aszmag transzkriptumainak vizsgálata két megfontolásból történt: egyrészt gyümölcshús és aszmagban közös szabályozóelemek azonosítása volt a cél, másrészt a receptákulum-specifikus gének elkülönítése a mindkét szövettípusban m köd génekt l (15. táblázat). A hierarchikus klaszterelemzés (Eisen et al. 1998) alapján az aszmagban expresszálódó gének csoportja élesen elkülönül a gyümölcshúsban jelen lev gének csoportjától (17. ábra). Az, hogy az aszmag-specifikus TDF-ek egy klaszterbe csoportosultak azt mutatja, hogy az aszmag érése során nincs szignifikáns változás a génexpressziós mintázatban. Hasonló eredményekr l számol be Aharoni és O Connell (2002), microarray módszerrel a gyümölcsben megfigyelt génexpressziós változásokhoz képest az aszmagban szintén nem tapasztaltak szignifikáns mintázatbeli eltérést. A 120 aszmag-specifikus TDF közül 40-et szekvenáltunk meg. Ezeknek 50%-a kismérték hasonlóságot vagy egyáltalan nem ad homológiát génbanki szekvenciákkal (18.ábra. C). A következ nagyobb csoportot a 7 (12,5%), ismeretlen funkciójú fehérjét kódoló klónok reprezentálják. A TDF-ek 10%-a (4 klón) stressz és védekezési reakciókban resztvev transzkriptumokat foglal magába. Ez a géncsoport az aszmag érése során stressz és kiszáradás toleranciát biztosít. A szamóca 1-Cys peroxiredoxin (1-Cys Prx) (C23M21M004)

58 58 Eredmények és megvitatásuk Fagopyrum esculentum-ból (pohánka) izolált homológjáról (AAF12782) bizonyították, hogy a magfejl dés során specifikusan expresszálódik (Lewis et al. 2000). 15. táblázat. Aszmagból izolált transzkriptumok és homológiájuk cdns-aflp fragmentum C11M31M014 GenBank hivatkozási szám DQ Feltételezett azonosság ACP5 (5-ös típusú sav foszfatáz) Feltételezett funkció Ismeretlen C11M31M015 AAT46620 Citokróm P450 Ismeretlen C11M32M003 AY Nitrilázszer fehérje C11M34M001 AY Nitrit reduktáz Hormon metabolismus Nitrát metabolizmus C11M34M002 DQ Kálium csatorna Ismeretlen C13M13M002 AJ315844* Lipid transzfer fehérje gén lpt46 Zsírsavak C14M12M004 AY H sokk fehérje Stressz C14M13M001 AY kDa glikoprotein prekurszor Ismeretlen C14M13M002 AY RING cink-ujj Szabályozás C14M21M003 DQ Kalmodulin-köt fehérje Jelátvitel C14M31M001 AY Feltételezett foszfatáz 2C (PP2C) C14M33M002 AY Feltételezett nitrát transzporter Jelátvitel Nitrát metabolizmus C14M33M003 AY Kis h sokk fehérje Stressz C23M12M004 AY ß-amirin szintáz Triterpén metabolizmus C23M21M002 AY Tartalékfehérje Tartalékfehérje C23M21M004 AY cisz peroxiredoxin Stressz C23M31M002 AY UDP-glükuronoziltranszferáz Szénhidrát anyagcsere C23M31M009 AY Citokróm P450 Ismeretlen C23M33M006 X15590* 18S riboszmális rrns Ismeretlen Feltételezett auxin-független C24M43M002 AY növekedés serkent * Az NCBI adatbankjába már leadott szamóca gének Ismeretlen Homológia azonosító száma, faj neve NP_ Arabidopsis BAD06417 Asparagus officinalis AAG52493 Arabidopsis AB Prunus persica CAB62555 Daucus carota AJ Fragaria ananassa AAN74634 Pisum sativum AAL86739 Corylus avellana NP_ Arabidopsis NP_ Arabidopsis At2g29380 Arabidopsis BAB56042 Oryza sativa P30222 Petunia x hybrida BAB83088 Betula platyphylla A Theobroma cacao AAF12782 Fagopyrum esculentum AAB99950 Pisum sativum CAA70575 Nepeta racemosa X15590 Fragaria ananassa BAD69015 Oryza sativa E érték 5e-10 2e-14 1e-17 2e-75 5e-14 3e-06 7e-17 1e-30 1e-25 8e-06 1e-10 5e-25 1e-40 2e-37 4e-23 4e-25 1e-04 2e-16 3e-08 6e-23

59 59 Eredmények és megvitatásuk A peroxiredoxinoknak antioxidáns szerepük van, a reaktív oxigéngyököket és a lipid peroxidázokat bontják, valamint jelátvitelkor szabályozzák a reaktív oxigéngyök és a peroxid szintet. Korábbi funkcionális elemzések szerint az 1-Cys Prx DNS-véd enzim, ugyanakkor szerepet játszik a mag nyugalmi állapotának fenntartásában (Stacy et al. 1996). Dohányban túltermeltetett rizs 1-Cys Prx hatására a növények fokozott rezisztenciát mutattak antioxidáns stresszel szemben, és kevésbé befolyásolták a mag nyugalmi állapotát, azt sugallva, hogy az 1-Cys Prx-nak az antioxidáns aktivitás az els dleges szerepe (Lee et al. 2000). A ß-amirin szintáz gén (C23M12M004) a szaponin bioszintézisének egyik kulcsenzime. A szaponinok másodlagos metabolitok, valószín leg gombaellenes hatásuk van (Papadopoulou et al. 1999). A másik két, stressz válaszhoz kötött klón (C14M33M003 és C14M12M004), h sokk fehérjéket kódoló génekkel mutatott homológiát. A transzkriptumok kisebb százaléka (5%) jelátviteli mechanizmusokért felel s. Ide tartozik a kalmodulin (C14M21M003) és egy feltételezett fehérje foszfatázt kódoló gén (C14M31M001). Növényi sejtekben a szabad Ca 2+ szint változásának els dleges szenzora a kalmodulin, kalcium köt fehérje (Roberts és Harmon, 1992). A citoszólikus szabad Ca 2+ a magban az ABA jelátviteli útvonal másodlagos messengere (Leung és Giraudat, 1998). Ismert, hogy az ABA-nak fontos szerepe van a mag érésében. Sok fontos gént indukál (tartalékfehérjék, lipideket kódoló gének, embriogenézisért felel s gének), és aktívan gátolja a csírázást. Az ABA válaszban részt vesznek a 2C foszfatázok csoportjába tartozó fehérjék is (Leung et al. 1998). Az általunk azonosított foszfatáz közeli homológiát mutat az Arabidopsis-ból izolált ABI1-el, ami az ABA jelátvitelben negatív szabályozó (Gosti et al. 1999). A klónok 5%-a (két TDF) nitrát metabolizmusban résztvev fehérjéket kódol: C11M34M001 nitrát reduktáz, C14M33M002 feltételezett nitrát transzporter Teljes hosszúságú cdns-ek izolálása és jellemzése Mivel a kapott TDF-ek viszonylag rövidek ( bp) és a cdns 3' végét képviselik (Breyne et al. 2003), a pontosabb szekvenciainformáció érdekében RACE reakcióval 2 génnek felszaporítottuk az 5' végét, 7 génnek pedig a teljes hosszúságú cdns-ét. Ezeket a fragmentumokat egyrészt az expressziós mintázatuk (19. ábra), másrészt a gyümölcsfejl désben és az érésben betöltött potenciális funkciójuk miatt választottuk. Az eredeti és a RACE reakciók után kapott fragmentum hosszak, valamint ezek homológjai és az E értékek RACE reakciók után az 16. és 17. táblázatokban vannak felsorolva. Bár az eredeti

60 60 Eredmények és megvitatásuk és RACE-el kapott szekvenciák hossza közt szignifikáns különbség van, homológjaik azonosak, kivétel a C24M43M007 klón, ahol, az eredeti 210 bp-nyi szekvenciával nem találtunk homológiát, míg a teljes 5' fragmentum nagyfokú homológiát (E value = e-135) mutat egy almából izolált vízcsatorna fehérje génnel. Ez azt mutatja, hogy táblázatokban felsorolt TDF-ek homológiái megbízható eredmények C11M32M003 (FaNit) C14M13M002 (FaRingH2) C14M21M006 (FaRLK1) C24M33M004 (FaSPA) C24M33M010 (FaRLK2) C24M44M003 (FaHd) GAPDH (kontroll) 19. ábra. Az érés indukálta gének expressziója szemikvantitatív RT-PCR-rel. Minták: gyümölcshús 1: zöld, 2: fehér, 3: rózsaszín 4: piros érési stádiumban. 16. táblázat. A kiinduló és a teljes hosszúságú 5' vég cdns-ek hossza, homológiájuk és az E értékek és az azonosság mértéke a 5' RACE reakció el tt és után cdns-aflp fragmentum Fragmentum hossza 5' RACE el tt és után Legvalószín bb homológia 5' RACE el tt és után C23M42M bp AAA-típusú ATPáz C24M14M bp Spermidin szintáz E érték 5' RACE el tt és után (Blastx) 1e-24 e /116 (57%) 294/500 (58%) e /324 (81%) Az érés specifikus C23M42M006 TDF egy Arabidopsis AAA-típusú ATP-ázt (NP_564824) kódol. Az AAA-típusú ATPázok (ATPases Associated with diverse cellular Activities) szerkezeti sajátossága egy nagyon konzervált AAA motívum jelenléte. Különböz sejtfunkciók ellátásában vesznek részt, mint például a sejt-ciklus szabályozása, sejtszervecske biogenezis, vezikulum közvetítette fehérjetranszport, fehérje lebomlás és chaperon-szer aktivitás (Patel és Latterich 1998).

61 61 Eredmények és megvitatásuk Az alma spermidin szintázzal (BAC20170) homológiát mutató szamóca klón (C24M14M007) transzkriptum akkumulációja érés specifikus, a rózsaszín és piros gyümölcshúsban és az érett aszmagban van jelen. A spermidin szintáz túltermeltetése Arabidopsis-ban fokozta a transzgénikus növények stresszt rését környezeti stresszfaktorokkal szemben, és stresszválaszban szerepet játszó géneket indukált. Ezek az eredmények azt mutatják, hogy a spermidin részt vesz a stressz indukálta jelátviteli utakban, el segítve a növények stressztoleranciájának kialakulását (Kasukabe et al. 2004). 17. táblázat. A kiinduló és a teljes cdns-ek hossza, homológiájuk és az E értékek és az azonosság mértéke a RACE reakció el tt és után cdns-aflp fragmentum C11M32M003 Fragmentum hossza RACE el tt és után bp Legvalószín bb homológia Feltételezett nitrilázszer fehérje C14M13M bp RING finger fehérje C14M21M bp Receptorszer kináz C24M33M bp bhlh fehérje (SPATULA) C24M33M010 *C24M43M007 C24M44M bp Receptorszer kináz bp bp Plazma membrán ferhérje (vízcsatorna fehérje) Feltételezett homeodoménzip fehérje E érték RACE el tt és után (Blastx) 7e-14 2e-17 41/64 (64%) 49/89 (55%) 3e-26 2e-45 51/92 (55%) 94/154 (61%) 1e /49 (67%) 379/698 (54%) e-46 21/59 (35%) 131/229 (57%) 1e /41 (63%) 395/593 (66%) No hit 8e /286 (91%) e /32 (65%) 234/318 (73%) *az egyedüli klón, aminek a cdns-aflp fragmentumhoz képest változott a homológiája RACE reakció után Nitrilázszer fehérjét kódoló gén A C11M32M003 cdns-aflp-fragmentum alapján felszaporított teljes hosszúságú cdns fehérje szinten a legnagyobb homológiát (55%) egy Arabidopsis-ból származó, feltételezhet en nitrilázszer fehérjével (AAG52493) mutatta. A 735 bp hosszúságú teljes cdns, 98 bp-nyi 5 UTR-t, 282 bp-os 3 UTR-t, és 357 bp hosszúságú ORF-t tartalmaz, mely

62 62 Eredmények és megvitatásuk egy 118 aminosavból álló fehérjét kódol (20. ábra). Elnevezése és hivatkozási száma: FaNit, AY A cdns expressziója az érés folyamán szupresszálódik az aszmagban és a gyümölcshúsban egyaránt, a transzkriptumok leginkább a zöld érési fázisban lev aszmagban és gyümölcshúsban halmozódnak fel (19. ábra). A nitrilázok (EC ) a nitrileket [például indol-3-acetonitril (IAN)] a megfelel karboxilsavvá (indol-3-ecetsav (IES) hidrolizálják, és szerepük lehet az IES bioszintézisében, amely a legnagyobb mennyiségben el forduló természetes auxin. Arabidopsis-ban az azonosított négy nitrilázt kódoló gén terméke közül az AtNIT1, AtNIT2 és AtNIT3 képesek az IAN IES konverzióra (Hillebrand et al. 1998), de az is ismert, hogy az auxin bioszintézisben nem töltenek be els dleges vagy egyedülálló szerepet. Kukoricában szintén bizonyították a nitriláz auxin bioszintézisben betöltött funkcióját, ahol a ZmNIT1 és ZmNIT2 felel az IAN IES átalakulásért (Park et al. 2003). Néhány nitrilázszer fehérjér l bizonyították, hogy kölcsönhatásba lép EREBP-kel (ethyleneresponsive element-binding protein), ezáltal szabályozva a különböz védekez mechanizmushoz tartozó génexpressziót (Xu et al. 1998). Szamócában a magas auxin szint el segíti a gyümölcs növekedését (Nitsch 1950), a gyümölcs érése viszont az aszmagból a receptákulumba történ auxin transzport megsz nésével veszi kezdetét, az aszmag érésével párhuzamosan (Archbold és Denni, 1984, Given et al. 1998), az auxin tehát és az érés negatív regulátora, gátolva számos érés specifikus gén m ködését (Manning 1994, 1998, Aharoni et al. 2002). 5' UTR 98 bp ORF 357 bp 3' UTR 282 bp ATG TGA 1. INTRON 732 bp 2. INTRON 550bp 20. ábra. A FaNit genomi klón szerkezete. A FaNit genomi klón szerkezete (20. ábra) hasonló az Arabidopsis homológ a 415 bp-b l alló genomi klónjához (AT5G15600), ez utóbbi klónban szintén egy intron van az 5' UTR-ben (107 bp) és egy az ORF-ben (74 bp), bár az intronok mérete eltér a szamócában leírthoz képest. A FaNit promoterének bioinformatikai elemzése során (az eddig izolált 482 bp), sem a promoterben, sem az 5' UTR-ben lev 732 bp-nyi I. intronban, nem találtunk auxin-válaszért

63 63 Eredmények és megvitatásuk felel s szabályozó régiót, amely jelenlétét a FaNit potenciális funkciója és expressziós mintázata miatt feltételeztük. Hormonális szabályozásért felel s elemek közül a FaRingH2 és FaSpa promoteréhez hasonlóan a FaNit promoterben is jelen van az etilén válaszért felel s cisz-elem egy-egy példánya az I. intronban és a promoterben (Balogh et al c) Ring finger fehérjét kódoló gén A RING fingert kódoló cdns-aflp fragmentum (C14M13M002) jelen van a zöld, gyümölcshúsban ahol az érés során gátlódik (19. ábra), valamint az aszmagban, ahol az érés minden fázisában kimutatható, de expressziója csökken. A teljes hosszúságú cdns 749 bp, ebb l 67 bp az 5 UTR, 208 bp a 3 UTR és 474 bp az ORF, amely egy 157 aminosavból álló fehérjét kódol. A genomi klón intront nem tartalmaz (21. ábra). 5'UTR 67 bp ORF 474 bp 3'UTR 208 bp ATG TGA 21. ábra. A FaRingH2 genomi klón szerkezete. Ez fehérje szintén egy Arabidopsis-ból származó C3HC4 típusú RING finger fehérjével (NP_178507) mutatja a legnagyobb homológiát, míg nukleotid szinten a görögdinnyéb l (Citrullus lanatus Thunb.) izolált RING fingerrel (AB182936). A fehérje C-terminális régiója a 102 és 143-as aminosavak közt egy jellegzetes RING-H2 domént tartalmaz: C-X2-C-X14- C-X-H-X2-H-X2-C-X3-W-X7-C-P-X-C (Jensen et al. 1998) (22, 23. ábra), továbbá a SMART software-el egy transzmembrán domént is azonosítottunk a aminosavak közt (22. ábra). RING 22. ábra. A SMART program által fehérje szinten felismert domének: aminosavak közt lev transzmembrán domén (henger), 102 és 143-as aminosavak közt RING-H2 domén (rombusz), aminosavak közt szerin gazdag régió (elipszis).

64 64 Eredmények és megvitatásuk A RING domén szerkezetéb l adodóan a szamóca homológot FaRingH2-nek neveztük el, GenBank-i hivatkozási száma: AY A RING fingert (Really Interesting New Gene) (Hanson et al. 1991) eredetileg mint ciszteinben gazdag, feltételezett cink-köt motívumot írták le, ami jelen van egymással nem rokon fehérjékben (Freemont et al. 1991), ugyanakkor az Arabidopsis proteomban a leggyakrabban detektált domén (Kosarev et al. 2002). Aminosav szintén a RING finger egy rövid, Cys/His-gazdag (C3HC/HC3) cink-ujj domén, amely, attól függ en, hogy a motívum ötödik helyén Cys vagy His van jelen, két különböz változatban fordul el, RING-HC és RING-H2 formában (Freemont 2000). A DNS köt cink ujj domént l eltér en a RING domén a fehérje-fehérje kölcsönhatásban vesz részt (Borden 2000). Növényekben, a legtöbb RINGfingert kódoló gént Arabidopsis-ban azonosították, ezek többsége RING-H2 fehérje gén (Jensen et al. 1998, Lechner et al. 2002). Szerkezetileg, a RING-H2 motívumok helyzetét és multi-domén kombinációkat tekintve, ezek a RING-H2 fehérjék nagyon változatosak. Bár a RING-H2 domén legtöbbször multi-domén struktúrákban van jelen, amelyek általában tartalmaznak még egy sejtmembránt átér régiót vagy egy másik cink-ujj domént (Jensen et al. 1998, Stone et al. 2005), legalább 40 olyan egyszer szerkezet RING-H2 fehérje van jelen az Arabidopsis genomban, ami nem tartalmaz egyéb fehérje domént (Lechner et al. 2002, Molnár et al. 2002). A RING finger fehérjék számos szervezetben fontos szerepet játszanak a fejl dés szabályozásában. Növényekben eddig csak néhányat jellemeztek funkcionálisan. A C-terminális RING-H2 fehérjét kódoló BRH1 expresszióját brasszinoszteroidok befolyásolják (Molnár et al. 2002), és patogén eredet elicitorok (kitin) indukálják, az RHA2b szállító szövetekben akkumulálódik (Lechner et al. 2002), a RIE1 a mag fejl dése során expresszálódik (Xu és Li 2003). Az Arabidopsis SERRATE génje normális hajtásfejl désért felel s, és mint ilyen, a fejl dés során, a hajtás merisztémákban, valamint a szervkezdeményekben íródik át (Prigge és Wagner 2001), a kukoricából izolált ID1 pedig a virágzás idejét szabályozó fehérjét kódol (Kozaki et al. 2004). Az Arabidopsis PEX12 egy peroxiszómális membrán fehérjét kódol, a mátrix proteinek importjáért felel (Fan et al. 2005). Szintén Arabidopsis-ban számos RING fehérjér l bizonyították ubiquitin ligáz aktivításukat (Stone et al. 2005). NP_ MGLSSLPGPSEGMLCVILVNTALSISIVKG--IVRSFLGIVGISLSPSSS-SPSSVTVSS 57 AAM19707 MGLSSLPGPSEGMLCVILVNTALSISIFKG--IVRSVLHVLGIRLSQSSS-SPSSVTASS 57 FaRingH2 MGLSSLPAPSEGFMCVILVNTALSVSIIKG--LVRSILRIVGIRLSSSSSASPASPPSEE 58 AAP46154 MCLSNLPASSEGVICVVVMNTALSISIFKG--IVRSVLHIVDNRLAPFSS-SSSSILFPD 57 BRH1 MGFP--VGYTEVFLPKLFVQTLSILGFIRT--IVFSIFRFLGLSDFLEMD QT 48 RHA1b MGLP--TDFKELQIPGYVLKTLYVIGFFRD--MVDALCPYIGLPSFLDHN ET 48 RHA2b MGLQG--QLSDVSSDSIPLMLLALLATFFR--HVRSLLLFP OSISAP1 MAQRDKKDQEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAATASTS-SPSSLSSPV 59

65 65 Eredmények és megvitatásuk NP_ ENSSTSESFDFRVCQPESYLEEFRNRTPTLRFESLCRCKKQADNECSVCLSKFQGDSEIN 117 AAM19707 EIP-ASEPFDFRVSHPESFLEEFRNKTPTLRYESLCRCKKHEDNECSVCLSKFEEDSEIN 116 FaRingH2 YIEDPSETFELHLSSSGSYIEEIRSRIPAVRFDSVCNLKTEHD--CSVCLSEFQPESEIN 116 AAP46154 YSD--TESFEFPLHSSDDCVRELRSRRPAKRFDAVSSCK-QPQHDCPVCLIQFKPDSEIN 114 BRH1 WPDYTSYPTRIPETRSPFSALLIREILPVIKFEELTNSGEDLPENCAVCLYEFEGEQEIR 108 RHA1b S---RSDPTRLALSTS---ATLANELIPVVRFSDLLTDPE---DCCTVCLSDFVSDDKIR 99 RHA2b -----SSAPVVVVTSNLSVLADQLNLNRLFSYRYSDNAAS----DCIVCLSKLKTGEEVR 88 OSISAP1 LDKQPPRPAAPLVEPQAPLPPPVEEMASALATAPAPVAKTSAVNRCSRCRKRVGLTG NP_ KLK-CGHLFHKTCLEKWI-DYWNITCPLCRTPLVVVP--EDH----QLSSNVW AAM19707 KLK-CGHLFHKTCLEKWI-DYWNITCPLCRTPLVVVAAAEDQK---QLSSNVW FaRingH2 HLT-CGHVFHQDCLEKWL-NYWNITCPLCRTPLMPVE ETSCFW AAP46154 CLS-CGHVFHKACLEKWL-DYRKVTCPLCKSPVMPEE EDTSSSW BRH1 WLRNCRHIFHRSCLDRWM-DHDQKTCPLCRTPFVPDEMQEEFNQRLWAASGVHDFHCPVT 167 RHA1b QLPKCGHVFHHRCLDRWIVDCNKITCPICRNRFLPEEKSTPFD---WGTSDWFRDEVEST 156 RHA2b KLD-CRHVFHKQCLEGWL-QHLNFNCPLCRSPLLPHHHQGHGS---DASISAFPLRSTST 143 OSISAP1 FRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP VVRAAKIVRF NP_ AAM FaRingH AAP BRH1 ELL- 170 RHA1b N RHA2b ASSH 147 OSISAP ábra. A FaRingH2 (AAV33472) és néhány RING finger fehérje aminosavszekvenciájának összehasonlítása: NP_ (Arabidopsis thaliana), AAM19707 (Thellungiella halophila), AAP46154 (Hevea brasiliensis), BRH1 (AAD27870, Arabidopsis thaliana), RHA1b (Q9SUS5, Arabidopsis thaliana), RHA2b (AAD14516, Arabidopsis thaliana), OSISAP1 (AAF74344, Oryza sativa) aminosav szekvenciájának összehasonlítása Clustal W programmal. A jelölt aminosavak a C-X2-C-X14-C-X-H-X2-H-X2-C-X3-W-X7- C-P-X-C RING finger domén konzervált aminosavjait képviselik (Jensen et al. 1998). A FaRingH2 sejtszint lokalizációját a FaRingH2-GFP fúzió rizs protoplasztban történ tranziens expressziójával határoztuk meg. Eredményeink szerint (26. ábra. C., D) a FaRingH2 a citoplazmában m ködik, lokalizációja azonos a kontroll (Pro 35S -GFP) (26. ábra. A., B) citoplazmatikus jelenlétével. A FaRingH2 promoterének bioinformatikai elemzése során (Balogh et al. 2005c) azonosítottunk egy AuxRR-szer (auxin responsive element) motívumot, ugyanez az elem a szamóca génnel homológ Arabidopsis gén (At2g04240) promoterében is megtalálható. Ez releváns lehet, ugyanis irodalmi adatok szerint valószín, hogy több RING-H2 cink finger motívumot tartalmazó fehérjének is szerepe van az auxin jelátvitelben, mégpedig a szubsztrátspecifikus ubiquitin úton végbemen fehérje degradációban (Xie et al. 2002). Az etilén szabályozó szerepére utalhat az ERE motívum (Itzhaki et al. 1994) jelenléte, a CAAACAC szekvencia tartalékfehérjék promoterének specifikus eleme, valószín leg felel s a FaRingH2 aszmagi expresszióért (Stalberg et al. 1996).

66 66 Eredmények és megvitatásuk Két receptorszer kináz A C14M21M006 cdns-aflp fragmentum alapján piros gyümölcsb l felszaporított teljes hosszúságú cdns egy receptorszer kinázt kódol. A teljes hosszúságú cdns 108 bpnyi 5' UTR-t, 2061 bp-nyi kódoló régiót és 322 bp-nyi 3' UTR-t foglal magaba. Fehérje szinten a legnagyobb homológiát (57%) egy Arabidopsis leucin gazdag receptorszer kináz fehérjével mutatja (AK176866). A homológia alapján a szamóca receptorszer kináz gént FaRLK1-nek neveztük el (AY940166). A C24M33M010 cdns-aflp fragmentum szintén egy receptorszer kinázt kódol. A RACE-el, piros gyümölcsb l izolált teljes hosszúságú cdns 89 bp-nyi 5' UTR-t, 1875 bp-nyi kódoló régiót és 113 bp-nyi 3' UTR-t foglal magába. A 624 aminosavból alló fehérje a legnagyobb homológiát (66%) egy Arabidopsis kinázzal mutatja (NP_177209), elnevezése és GenBank-i hivatkozási száma: FaRLK2, AY Mindkét szamóca receptorszer kináz transzkriptumának akkumulálódása az érés során indukálódik (19. ábra). Tipikusan, egy receptorszer kináz egy N-terminális szignál peptidb l, egy extracelluláris receptor doménb l, egy transzmembrán doménb l és egy citoplazmatikus szerin/treonin specifitással rendelkez kináz doménb l áll. A ligandum köt dése az extracelluláris doménhez indukálja a citoplazmatikus kináz domént, ami az RLK autofoszforilációjáhaz és a szubsztrát fehérjék transzfoszforilációjához vezet. A foszforilált fehérjék továbbítják a szignált és ligandum-specifikus választ idéznek el. A receptorszer kinázok (RLK-receptor-like kinase) egy nagy RLK/Pelle géncsaládba tartoznak, amely Arabidopsis-ban több mint 600 tagot tartalmaz (Shiu et al. 2004). Biológiai funkciójuk szerint az RLK/ Pelle géncsalád tagjai két nagy csoportba sorolhatók. Az els csoportba tartoznak a növény növekedését és fejl dését szabályozó gének, mint például az Arabidopsis-ban azonosított és a szervek alakját meghatározó ERECTA (Torii et al. 1996), vagy a merisztéma fenntartásáért felel s CLAVATA1 (Clark et al. 1997), és a sejtnövekedést szabályozó BRI1 (Li és Chory, 1997). A második csoportba a növény-mikróba kölcsönhatásért és védekezési mechanizmusokért felel s RLK-k tartoznak. Ilyen például a bakteriális patogén rezisztenciáért felel s rizs Xa21 (Song et al. 1995), a flagellin érzékeléséért felel s Arabidopsis FLS2 (Gomez-Gomez és Boller 2000) és a szisztemin jelátvitelben résztvev paradicsom SR160 (Scheer és Ryan 2002). A két szamóca receptor kináz szerkezetileg eltér egymástól (24. ábra). A SMART és Pfam programokkal mindkét fehérjében azonosítható volt egy transzmembrán és egy kináz domén, az N-terminális vég viszont eltér felépítés. A C14M21M006 tartalamaz egy N-

67 67 Eredmények és megvitatásuk terminális leucinben gazdag domént és leucinben gazdag ismétl dést (24. ábra A). A C24M33M010 N-terminális végén két ismeretlen funkciójú domén található (24. ábra B). A. B. 24. ábra. A SMART és Pfam programok által fehérje szinten felismert domének: A: receptorszer kináz (FaRLK1): zöld: leucinben gazdag N-terminális domén (24-65 aminosavak), piros: leucinben gazdag ismétl dések ( aminosavak), kék: transzmembrán domén ( aminosavak), sárga: kináz domén ( aminosavak). B: receptorszer kináz (FaRLK2): zöld: ismeretlen funkciójú domének (29-84 és aminosavak), kék: transzmembrán domén ( aminosavak), kináz domén ( aminosavak). A FaRLK1 és FaRLK2 promoterekben azonosított szabályozóelemek összehasonlítása alapján elmondható, hogy a FaRLK1 az abszcizinsav válaszban vesz részt, a FaRLK2 pedig sebzés és elicitorok hatására aktiválódik. Az RLK2 promoterében metil-jázmonát-, sebzés- és auxinválaszért felel s elemeket is azonosítottunk (Koncz, el készületben). A kinázok katalizálta fehérje foszforiláció kulcsszerepet tölt be az eukarióta jelátvitelben, és így valószín leg részt vesznek a gyümölcsfejl désben. Jelen esetben, az is elképzelhet, hogy a két receptorszer kináz gén expressziójának indukálódása az érést kísér, patogénekkel szemben fokozott érzékenység válaszreakciója Az Arabidopsis SPATULA génnel homológ szamóca gén A C24M33M004 érésindukálta transzkriptum a bhlh fehérjék csoportjába tartozó transzkripciós faktort kódol. A teljes cdns 1404-bp méret, amely magába foglalja a 23-bp-

68 68 Eredmények és megvitatásuk nyi 5' UTR-t, a 1098-bp-nyi ORF-t és a 283-bp-nyi 3' UTR-t, egy 365 aminosavból álló fehérjét kódol. Elnevezése és GenBank-i hivatkozási száma: FaSpa, AY679615). A SMART programcsomaggal a 150 és 199 aminosavak közt egy alap spirál-hurok-spirál (bhlh) (basichelix-loop-helix) domént azonosítottunk. Fehérje szinten a legnagyobb homológiát (51%) az Arabidopsis-ból izolált SPATULA-val, egy bhlh fehérjével mutatja (NP_568010). Néhány növényi bhlh fehérje részt vesz az antocianin bioszintézis szabályozásában (Goodrich et al. 1992), másoknak az abszcizinsav és dehidratáció válaszreakcióban van szerepük, vagy a mag tartalékfehérje gének expressziójának szabályozásáért felelnek (Kawagoe és Murai 1996). Az Arabidopsis SPATULA génje a term levelek fejl désében játszik szerepet, de jelen van más szövetekben is, ahol növekedésért lehet felel s. A SPATULA mutánsaiban a bibeszál, a bibe és a replum (választófal) növekedése korlátozott (Alvarez és Smyth, 1999; Heisler et al. 2001). Szamócában a transzkriptum érés során akkumulálódik (19. ábra), ugyanakkor RT- PCR-el kimutatható volt aszmagban, indában, az inda csúcsi részében és levélben is. A FaSPA esetleges hormonális szabályozására utalhatnak a promoterében megtalálható, hormon-válaszhoz kötött elemek. Az Arabidopsis SPATULA gén promoterében Heisler et al. (2001) több AuxRE-szer motívum jelenlétér l számol be, ami arra enged következtetni, hogy az auxin a SPATULA transzkripciós szintjét is befolyásolja. A FaSPA promoterében az AuxRE (auxin responsive element) motívum részeként egy TGA-1 boxot azonosítottunk. Az auxin mellett, az etilén szabályozó szerepére utalhat az ERE (ethylene responsive element) jelenléte. A FaSPA upstream szekvenciájában az Itzhaki et al. (1994) által leírt, etilénhez kapcsolt ERE szabályozó elem (ATTTCAAA) különböz formái négyszer fordulnak el a szamóca esetében, és háromszor az Arabidopsis SPA promoterében (Balogh et al. 2005c). Ismert, hogy bizonyos esetekben egynél több cisz elem jelenlétére van szükség néhány transzkripciós faktor stabil köt déséhez (Ulmasov et al. 1999). Bár a többször el forduló ERE-k funkciója hasonló lehet, az ismétl dés biológiai jelent sége és a szamóca SPATULA génjének hormonális szabályozása bizonyításra szorul. A FaSPA promoter további részletes bioinformatikai és funkcionális elemzést igényel. A szamóca SPATULA gén genomi klónjának szerkezetét még nem határoztuk meg, az Arabidopsis genomi klón (AT4G36930) szerkezete: 5' UTR: 40 bp, ORF: 1778 bp, 3' UTR: 348 bp, az ORF 6 intront tartalmaz (Intron 1: 231 bp, Intron 2: 71 bp, Intron 3: 96 bp, Intron 4: 93 bp, Intron 5: 77 bp, Intron 6: 83 bp).

69 69 Eredmények és megvitatásuk Plazma membrán ferhérjét (vízcsatorna fehérjét) kódoló szamóca gén A C24M43M007 fragmentum alapján felszaporított teljes hosszúságú cdns fehérje szinten a legnagyobb homológiát (91%) egy alma MdPIP1a (BAD14371) vízcsatorna fehérjével mutatja. Nagy homológiát (89%) mutat továbbá a szintén alma MdPIP1b (BAD14372), valamint a körte Py-PIP1-1 (BAB40142) génekkel is. Az 1277 bp-nyi teljes hosszúságú cdns egy 101 bp-nyi 5 UTR-t, 285 bp-os 3 UTR-t, és 891 hosszúságú ORF-t tartalmaz. Elnevezése és hivatkozási száma: FaPIP, DQ A transzkriptum felhalmozódása zöld gyümölcshúsra jellemz, majd csökken az érés során. A FaPIP fehérje szinten a aminosavak között egy, az aquaporinokra jellemz MIP (Major Intrinsic Protein) domént tartalmaz (Pfam adatbázis szerint). A plazma membrán fehérjék (PIP) az aquaporinok alcsaládját alkotják. A PIP1 és PIP2 funkcionális elemzése azt mutatja, hogy ezek a fehérjék részt vesznek a gyökér vízfelvételében, stressz-válaszban és CO 2 transzportban (Siefritz et al. 2002). Dohányban, a PIP2-r l bizonyították a portok kiszáradásában és ezáltal a portok felnyílásában betöltött szerepét (Bots et al. 2005). Az aquaporinok általánosabb szerepe a sejt növekedésében és ozmotikus szabályozásban van (Maurel et al. 2002). A zöld, növekedésben lev szamóca gyümölcsben azonosított FaPIP a MdPIP1-hez hasonlóan a gyümölcs növekedése során a sejt expanziójáért a víz homeosztázisának fenntartása révén lehet felel s (Hu et al. 2003) Homeodomén fehérjét kódoló szamóca gén A C24M44M003 cdns-aflp fragmentum egy homeodomént tartalmazó fehérje génjével mutatott hasonlóságot. A transzkriptum a gyümölcshúsban az érés során akkumulálódik (19. ábra). Az érett gyümölcsb l izolált RNS-b l RACE-el felszaporított teljes hosszúságú cdns 1188 bp, ebb l 133 bp az 5' UTR, 915 bp az ORF és 140 bp a 3' UTR. Elnevezése és GenBank-i hivatkozási száma: FaHd, AY Fehérje szinten a legnagyobb (72%) azonosságot egy Solanum demissum Lindl.-ban azonosított HD-zip fehérjével mutatja (AAT39931). Továbbá 64% hasonlóságot mutat az Arabidopsis-ban leírt ATHB13 (AAF20996), valamint 43%-ot és HAT7 (NP_568309) fehérjékkel. Fehérje szinten a SMART programmal a aminosavak között egy homeodomént azonosítottunk. A homeodoménleucin cipzár (HDZip) fehérjék látszólag csak a növényekre jellemz transzkripciós faktorok népes családját reprezentálják. Jellemz jük, a homeodomén mellett, egy leucin cipzár domén

70 70 Eredmények és megvitatásuk jelenléte, ezek révén dimereket alkotnak, ami els dleges feltétele a DNS kötésnek. A HDZip géncsaládnak Arabidopsis-ban 47 tagja van (Henriksson et al. 2005). A legtöbb Arabidopsis HDZip gén funkciója ismeretlen, az ismert funkciójú gének a növény fejl désében töltenek be kulcsszerepet (Hanson et al. 2002). Az ATHB13 fehérje a szaharóz szignál transzdukciós út komponense lehet, konstitutív túltermeltetése cukorfügg módosulásokat idéz el a sziklevélés levélfejl désben (Hanson et al. 2001). Az ANTHOCYANINLESS2 az antocianin eloszlást és gyökérfejl dést befolyásolja Arabidopsis-ban (Kubo et al. 1999). Két másik HDZip gén, a PHABULOSA és PHAVOLUTA a hajtás sugaras szervezettségét szabályozza (McConnell et al. 2001). 5'UTR 133 bp ORF 915 bp 3'UTR 140 bp ATG TGA 1. INTRON 85 bp 2. INTRON 462 bp 25. ábra. A FaHd genomi klón szerkezete. A genomi klón szerkezete (25. ábra), intronok száma és helyzete azonos a Solanum demissum Lindl. 304 aminosavat kódoló HD-zip génjével, viszont ezek mérete 901 bp és 422 bp, ami jóval nagyobb a szamóca Hd-zip génben ismertnél. Az Arabidopsis ATHB13 gén szintén két intronos, egy 80 és egy 233 bp-nyi intron szakítja meg a kódoló régiót. A FaHd sejtszint lokalizációját FaHd-GFP fúziós fehérje segítségével határoztuk meg. Eredményeink szerint (26. ábra. E., F) a FaHd a sejtmagban m ködik, a kontrolltól (Pro 35S -GFP) eltér módon (26. ábra. A., B), ahol az expresszió citoplazmatikus, a FaHd-GFP teljes mértékben a sejtmagban lokalizálódik, ami összhangban van a homeodomén fehérjék sejtmagi transzkripciós faktor szerepével. A HD-zip géneket már kapcsolatba hozták a gyümölcséréssel, bár az eddigi adatok csak az érett gyümölcsöt reprezentáló EST gy jteményben való jelenlétüket bizonyítják (paradicsom, barack), az érésben betöltött szabályozó szerepük teljesen ismeretlen (Fei et al. 2004, Ziliotto et al. 2005).

71 71 Eredmények és megvitatásuk CaMV35S GFP NOS A. B. CaMV35S FaRing GFP NOS C. D. CaMV35S FaHd GFP NOS E. F. 26. ábra. A FaRING és FaHd fehérjék szubcelluláris lokalizációja GFP fúzióval. A., B.: Pro 35S : GFP, C., D.: Pro 35S : FaRingH2-GFP, E., F.: Pro 35S : FaHd-GFP tranziens expressziója rizs protoplasztokban. A., C., E. GFP UV-fénnyel gerjesztve, B., D., F. fehér fényben

DNS molekulák elválasztása agaróz gélelektroforézissel és kapilláris elektroforézissel

DNS molekulák elválasztása agaróz gélelektroforézissel és kapilláris elektroforézissel DNS molekulák elválasztása agaróz gélelektroforézissel és kapilláris elektroforézissel Gyakorlat helye: BIOMI Kft. Gödöllő, Szent-Györgyi A. u. 4. (Nemzeti Agrárkutatási és Innovációs Központ épülete volt

Részletesebben

Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén

Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Molekuláris biológiai eljárások alkalmazása a GMO analitikában és az élelmiszerbiztonság területén Dr. Dallmann Klára A molekuláris biológia célja az élőlények és sejtek működésének molekuláris szintű

Részletesebben

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 NÖVÉNYÉLETTAN Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 Sejtfal szintézis és megnyúlás Környezeti tényezők hatása a növények növekedésére és fejlődésére Előadás áttekintése

Részletesebben

SZENT ISTVÁN EGYETEM. Termesztett szamócából származó, bhlh transzkripciós faktort kódoló SPATULA gén jellemzése. Doktori értekezés.

SZENT ISTVÁN EGYETEM. Termesztett szamócából származó, bhlh transzkripciós faktort kódoló SPATULA gén jellemzése. Doktori értekezés. SZENT ISTVÁN EGYETEM Termesztett szamócából származó, bhlh transzkripciós faktort kódoló SPATULA gén jellemzése Doktori értekezés Tisza Viktória Gödöllő 2011 A doktori iskola Megnevezése: Növénytudományi

Részletesebben

A basidiomycota élesztőgomba, a Filobasidium capsuligenum IFM 40078 törzse egy olyan

A basidiomycota élesztőgomba, a Filobasidium capsuligenum IFM 40078 törzse egy olyan A basidiomycota élesztőgomba, a Filobasidium capsuligenum IFM 40078 törzse egy olyan fehérjét (FC-1 killer toxint) választ ki a tápközegbe, amely elpusztítja az opportunista patogén Cryptococcus neoformans-t.

Részletesebben

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére

Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Genetikai panel kialakítása a hazai tejhasznú szarvasmarha állományok hasznos élettartamának növelésére Dr. Czeglédi Levente Dr. Béri Béla Kutatás-fejlesztés támogatása a megújuló energiaforrások és agrár

Részletesebben

A replikáció mechanizmusa

A replikáció mechanizmusa Az öröklődés molekuláris alapjai A DNS megkettőződése, a replikáció Szerk.: Vizkievicz András A DNS-molekula az élőlények örökítő anyaga, kódolt formában tartalmazza mindazon információkat, amelyek a sejt,

Részletesebben

3. gyakorlat: nukleinsav-tisztítás, polimeráz láncreakció

3. gyakorlat: nukleinsav-tisztítás, polimeráz láncreakció 3. gyakorlat: nukleinsav-tisztítás, polimeráz láncreakció A vírus genetikai anyagának vizsgálata (direkt víruskimutatási módszer) biztosítja a legrészletesebb és legspecifikusabb információkat a kimutatott

Részletesebben

Zárójelentés. Gabonafélék stresszadaptációját befolyásoló jelátviteli folyamatok tanulmányozása. (K75584 sz. OTKA pályázat)

Zárójelentés. Gabonafélék stresszadaptációját befolyásoló jelátviteli folyamatok tanulmányozása. (K75584 sz. OTKA pályázat) Zárójelentés Gabonafélék stresszadaptációját befolyásoló jelátviteli folyamatok tanulmányozása (K75584 sz. OTKA pályázat) A tervezett kísérletek célja, hogy jobban megértsük a növények változó környezetre

Részletesebben

A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata

A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata Ph.D. ÉRTEKEZÉS TÉZISEI A TATA-kötő fehérje asszociált faktor 3 (TAF3) p53-mal való kölcsönhatásának funkcionális vizsgálata Buzás-Bereczki Orsolya Témavezetők: Dr. Bálint Éva Dr. Boros Imre Miklós Biológia

Részletesebben

Génkifejeződési vizsgálatok. Kocsy Gábor

Génkifejeződési vizsgálatok. Kocsy Gábor Génkifejeződési vizsgálatok MTA Mezőgazdasági Kutatóintézete Növényi Molekuláris Biológia Osztály A génkifejeződés A sejtmag géneket tartalmaz; (fehérjéket, RNSeket kódoló); A gének átíródnak mrns; Pre-mRNS

Részletesebben

mintasepcifikus mikrokapilláris elektroforézis Lab-on-Chip elektroforézis / elektrokinetikus elven DNS, RNS, mirns 12, fehérje 10, sejtes minta 6

mintasepcifikus mikrokapilláris elektroforézis Lab-on-Chip elektroforézis / elektrokinetikus elven DNS, RNS, mirns 12, fehérje 10, sejtes minta 6 Agilent 2100 Bioanalyzer mikrokapilláris gélelektroforézis rendszer G2943CA 2100 Bioanalyzer system forgalmazó: Kromat Kft. 1112 Budapest Péterhegyi u. 98. t:36 (1) 248-2110 www.kromat.hu bio@kromat.hu

Részletesebben

Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással

Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Biomassza alapú bioalkohol előállítási technológia fejlesztése metagenomikai eljárással Kovács Zoltán ügyvezető DEKUT Debreceni Kutatásfejlesztési Közhasznú Nonprofit Kft. Problémadefiníció Első generációs

Részletesebben

AZ EMÉSZTÉS ÉLETTANA. Fehérjeemésztés kimutatása földigiliszta tápcsatornájában

AZ EMÉSZTÉS ÉLETTANA. Fehérjeemésztés kimutatása földigiliszta tápcsatornájában AZ EMÉSZTÉS ÉLETTANA Az állati szervezetek testük felépítéséhez szükséges anyagokat és energiát táplálék formájában veszik fel. Táplálékuk minısége szerint lehetnek húsevık, növényevık és mindenevık. A

Részletesebben

TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL

TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL Az egyes biomolekulák izolálása kulcsfontosságú a biológiai szerepük tisztázásához. Az affinitás kromatográfia egyszerűsége, reprodukálhatósága

Részletesebben

A kvantitatív PCR alkalmazhatósága a fertőző bronchitis vakcinák hatékonysági vizsgálatában. Derzsy Napok, Sárvár, 2011 Június 2-3.

A kvantitatív PCR alkalmazhatósága a fertőző bronchitis vakcinák hatékonysági vizsgálatában. Derzsy Napok, Sárvár, 2011 Június 2-3. A kvantitatív PCR alkalmazhatósága a fertőző bronchitis vakcinák hatékonysági vizsgálatában Pénzes Zoltán PhD, Soós Pál PhD, Nógrády Noémi PhD, Varga Mária, Jorge Chacón PhD, Zolnai Anna PhD, Nagy Zoltán

Részletesebben

Posztvakcinációs rotavírus surveillance Magyarországon, 2007-2011

Posztvakcinációs rotavírus surveillance Magyarországon, 2007-2011 Egyetemi doktori (Ph.D.) értekezés tézisei Posztvakcinációs rotavírus surveillance Magyarországon, 2007-2011 Antalné László Brigitta Témavezetők: Dr. Bányai Krisztián és Dr. Kónya József DEBRECENI EGYETEM

Részletesebben

A kadmium okozta nehézfémstressz vizsgálata

A kadmium okozta nehézfémstressz vizsgálata A kertészeti és mezőgazdasági növények termőképességét a környezeti biotikus és abiotikus stresszhatások nagymértékben befolyásolják. Az abiotikus környezeti stressz, mint például a szárazság, a nagy sótartalom,

Részletesebben

Patogén mikroorganizmusok vizsgálata molekuláris biológiai módszerekkel

Patogén mikroorganizmusok vizsgálata molekuláris biológiai módszerekkel Patogén mikroorganizmusok vizsgálata molekuláris biológiai módszerekkel Rohonczy Kata, Zoller Linda, Fodor Andrea, Tabajdiné, dr. Pintér Vera FoodMicro Kft. Célkitűzés Élelmiszerekben és takarmányokban

Részletesebben

Juhász Angéla MTA ATK MI Alkalmazott Genomikai Osztály SZEKVENCIA ADATBÁZISOK

Juhász Angéla MTA ATK MI Alkalmazott Genomikai Osztály SZEKVENCIA ADATBÁZISOK Juhász Angéla MTA ATK MI Alkalmazott Genomikai Osztály SZEKVENCIA ADATBÁZISOK Fehérjét kódol? Tulajdonságai? -Hol lokalizálódik? -Oldható? -3D szerkezete? -Accession #? -Annotációja elérhető? Már benne

Részletesebben

Növényvédelmi Tudományos Napok 2015

Növényvédelmi Tudományos Napok 2015 Növényvédelmi Tudományos Napok 05 Budapest 6. NÖVÉNYVÉDELMI TUDOMÁNYOS NAPOK Szerkesztők HORVÁTH JÓZSEF HALTRICH ATTILA MOLNÁR JÁNOS Budapest 05. február 7-8. ii Szerkesztőbizottság Kiss Levente Horváth

Részletesebben

DNS munka a gyakorlatban. 2012.10.12. Természetvédelmi genetika

DNS munka a gyakorlatban. 2012.10.12. Természetvédelmi genetika DNS munka a gyakorlatban 2012.10.12. Természetvédelmi genetika Munka fázisok DNS kivonás elektroforézis (fakultatív lépés) PCR Elektroforézis Szekvenálás Szekvencia elemzés faji azonosítás; variabilitás,

Részletesebben

Engedélyszám: 18211-2/2011-EAHUF Verziószám: 1. 2460-06 Humángenetikai vizsgálatok követelménymodul szóbeli vizsgafeladatai

Engedélyszám: 18211-2/2011-EAHUF Verziószám: 1. 2460-06 Humángenetikai vizsgálatok követelménymodul szóbeli vizsgafeladatai 1. feladat Ismertesse a gyakorlaton lévő szakasszisztens hallgatóknak a PCR termékek elválasztása céljából végzett analitikai agaróz gélelektroforézis során használt puffert! Az ismertetés során az alábbi

Részletesebben

Az endomembránrendszer részei.

Az endomembránrendszer részei. Az endomembránrendszer Szerkesztette: Vizkievicz András Az eukarióta sejtek prokarióta sejtektől megkülönböztető egyik alapvető sajátságuk a belső membránrendszerük. A belső membránrendszer szerkezete

Részletesebben

7. A b-galaktozidáz indukciója Escherichia coliban

7. A b-galaktozidáz indukciója Escherichia coliban 7. A b-galaktozidáz INDUKCIÓJA ESCHERICHIA COLIBAN 7. A b-galaktozidáz indukciója Escherichia coliban dr. Bauer Pál 7.1. Az enzimindukció jelensége Az élõlények valamennyi génjének állandó és folyamatos

Részletesebben

CzB 2010. Élettan: a sejt

CzB 2010. Élettan: a sejt CzB 2010. Élettan: a sejt Sejt - az élet alapvető egysége Prokaryota -egysejtű -nincs sejtmag -nincsenek sejtszervecskék -DNS = egy gyűrű - pl., bactériumok Eukaryota -egy-/többsejtű -sejmag membránnal

Részletesebben

A géntechnológia genetikai alapjai (I./3.)

A géntechnológia genetikai alapjai (I./3.) Az I./2. rész (Gének és funkciójuk) rövid összefoglalója A gének a DNS információt hordozó szakaszai, melyekben a 4 betű (ATCG) néhány ezerszer, vagy százezerszer ismétlődik. A gének önálló programcsomagként

Részletesebben

Diagnosztikai célú molekuláris biológiai vizsgálatok

Diagnosztikai célú molekuláris biológiai vizsgálatok Diagnosztikai célú molekuláris biológiai vizsgálatok Dr. Patócs Attila, PhD MTA-SE Molekuláris Medicina Kutatócsoport, Semmelweis Egyetem II. sz. Belgyógyászati Klinika Laboratóriumi Medicina Intézet Genetikai

Részletesebben

Silhavy Dániel. A növényi génexpresszió RNS-szintű minőségbiztosítási rendszereinek molekuláris biológiája. című Doktori Értekezésének bírálata.

Silhavy Dániel. A növényi génexpresszió RNS-szintű minőségbiztosítási rendszereinek molekuláris biológiája. című Doktori Értekezésének bírálata. Silhavy Dániel A növényi génexpresszió RNS-szintű minőségbiztosítási rendszereinek molekuláris biológiája című Doktori Értekezésének bírálata. Bíráló: Dr. Szabados László, MTA doktora MTA Szegedi Biológiai

Részletesebben

5. Molekuláris biológiai technikák

5. Molekuláris biológiai technikák 5. Molekuláris biológiai technikák DNS szaporítás kémcsőben és élőben. Klónozás, PCR, cdna, RT-PCR, realtime-rt-pcr, Northern-, Southernblotting, génexpresszió, FISH 5. Molekuláris szintű biológiai technikák

Részletesebben

BMGE, Alkalmazott biokémia, transzgénikus organizmusok, 2009 Transzformációs módszerek

BMGE, Alkalmazott biokémia, transzgénikus organizmusok, 2009 Transzformációs módszerek BMGE, Alkalmazott biokémia, transzgénikus organizmusok, 2009 Transzformációs módszerek Definíció Génbevitel vagy géntranszfer alatt azt a folyamatot értjük, aminek során egy meghatározott DNSmolekuladarab

Részletesebben

Új temékek az UD-GenoMed Kft. kínálatában!

Új temékek az UD-GenoMed Kft. kínálatában! Új temékek az UD-GenMed Kft. kínálatában! Műanyag termékek: SARSTEDT műanyag termékek teljes választéka Egyszer használats labratóriumi műanyag eszközök szövet és sejttenyésztéshez Vérvételi és diagnsztikai

Részletesebben

A másodlagos biogén elemek a szerves vegyületekben kb. 1-2 %-ban jelen lévő elemek. Mint pl.: P, S, Fe, Mg, Na, K, Ca, Cl.

A másodlagos biogén elemek a szerves vegyületekben kb. 1-2 %-ban jelen lévő elemek. Mint pl.: P, S, Fe, Mg, Na, K, Ca, Cl. A sejtek kémiai felépítése Szerkesztette: Vizkievicz András A biogén elemek Biogén elemeknek az élő szervezeteket felépítő kémiai elemeket nevezzük. A természetben található 90 elemből ez mindössze kb.

Részletesebben

Gyors DNS alapú mangalica specifikus kimutatási rendszer kidolgozás a MANGFIELD projekt keretében

Gyors DNS alapú mangalica specifikus kimutatási rendszer kidolgozás a MANGFIELD projekt keretében Gyors DNS alapú mangalica specifikus kimutatási rendszer kidolgozás a MANGFIELD projekt keretében SZÁNTÓ-EGÉSZ RÉKA 1, MOHR ANITA 1, SIPOS RITA 1, MICSINAI ADRIENN 1, KOPPÁNYNÉ SZABÓ ERIKA 2, JÁNOSI ANNA

Részletesebben

BIOLÓGIA VERSENY 10. osztály 2016. február 20.

BIOLÓGIA VERSENY 10. osztály 2016. február 20. BIOLÓGIA VERSENY 10. osztály 2016. február 20. Kód Elérhető pontszám: 100 Elért pontszám: I. Definíció (2x1 = 2 pont): a) Mikroszkopikus méretű szilárd részecskék aktív bekebelezése b) Molekula, a sejt

Részletesebben

INTERFERONI GAMMA-1B SOLUTIO CONCENTRATA. Tömény gamma-1b-interferon-oldat

INTERFERONI GAMMA-1B SOLUTIO CONCENTRATA. Tömény gamma-1b-interferon-oldat 01/2008:1440 javított 7.0 INTERFERONI GAMMA-1B SOLUTIO CONCENTRATA Tömény gamma-1b-interferon-oldat C 734 H 1166 N 204 O 216 S 5 M r 16 465 DEFINÍCIÓ A tömény gamma-1b-interferon-oldat a gamma interferon

Részletesebben

6. Zárványtestek feldolgozása

6. Zárványtestek feldolgozása 6. Zárványtestek feldolgozása... 1 6.1. A zárványtestek... 1 6.1.1. A zárványtestek kialakulása... 2 6.1.2. A feldolgozási technológia... 3 6.1.2.1. Sejtfeltárás... 3 6.1.2.2. Centrifugálás, tisztítás...

Részletesebben

Genomadatbázisok Ld. Entrez Genome: Összes ismert genom, hierarchikus szervezésben (kromoszóma, térképek, gének, stb.)

Genomadatbázisok Ld. Entrez Genome: Összes ismert genom, hierarchikus szervezésben (kromoszóma, térképek, gének, stb.) Genomika Új korszak, paradigmaváltás, forradalom: a teljes genomok ismeretében a biológia adatokban gazdag tudománnyá válik. Új kutatási módszerek, új szemlélet. Hajtóerõk: Genomszekvenálási projektek

Részletesebben

Molekuláris genetikai vizsgáló. módszerek az immundefektusok. diagnosztikájában

Molekuláris genetikai vizsgáló. módszerek az immundefektusok. diagnosztikájában Molekuláris genetikai vizsgáló módszerek az immundefektusok diagnosztikájában Primer immundefektusok A primer immundeficiencia ritka, veleszületett, monogénes öröklődésű immunhiányos állapot. Családi halmozódást

Részletesebben

Transzgénikus növények alkalmazása a funkcionális genomikai kutatásokban

Transzgénikus növények alkalmazása a funkcionális genomikai kutatásokban Transzgénikus növények alkalmazása a funkcionális genomikai kutatásokban MTA Agrártudományi Kutatóközpont Növényi Sejtbiológia Osztály Gyakorlatban alkalmazható transzgénikus növények létrehozásának alapfeltétele:

Részletesebben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK

Részletesebben

4. SZERVES SAVAK. Az ecetsav biológiai előállítása SZERVES SAVAK. Ecetsav baktériumok. Az ecetsav baktériumok osztályozása ECETSAV. 04.

4. SZERVES SAVAK. Az ecetsav biológiai előállítása SZERVES SAVAK. Ecetsav baktériumok. Az ecetsav baktériumok osztályozása ECETSAV. 04. Az ecetsav biológiai előállítása 4. SZERVES SAVAK A bor után legősibb (bio)technológia: a bor megecetesedik borecet keletkezik A folyamat bruttó leírása: C 2 H 5 OH + O 2 CH 3 COOH + H 2 O Az ecetsav baktériumok

Részletesebben

ZSÍRSAVAK OXIDÁCIÓJA. FRANZ KNOOP német biokémikus írta le először a mechanizmusát. R C ~S KoA. a, R-COOH + ATP + KoA R C ~S KoA + AMP + PP i

ZSÍRSAVAK OXIDÁCIÓJA. FRANZ KNOOP német biokémikus írta le először a mechanizmusát. R C ~S KoA. a, R-COOH + ATP + KoA R C ~S KoA + AMP + PP i máj, vese, szív, vázizom ZSÍRSAVAK XIDÁCIÓJA FRANZ KNP német biokémikus írta le először a mechanizmusát 1 lépés: a zsírsavak aktivációja ( a sejt citoplazmájában, rövid zsírsavak < C12 nem aktiválódnak)

Részletesebben

10. Genomika 2. Microarrayek és típusaik

10. Genomika 2. Microarrayek és típusaik 10. Genomika 2. 1. Microarray technikák és bioinformatikai vonatkozásaik Microarrayek és típusaik Korrelált génexpresszió mint a funkcionális genomika eszköze 2. Kombinált megközelítés a funkcionális genomikában

Részletesebben

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai A BIOLÓGIA ALAPJAI A tananyag felépítése: Környezetmérnök és műszaki menedzser hallgatók számára Előadó: 2 + 0 + 0 óra, félévközi számonkérés 3 ZH: október 3, november 5, december 5 dr. Pécs Miklós egyetemi

Részletesebben

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!!

12/4/2014. Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció. 1952 Hershey & Chase 1953!!! Genetika 7-8 ea. DNS szerkezete, replikáció és a rekombináció 1859 1865 1869 1952 Hershey & Chase 1953!!! 1879 1903 1951 1950 1944 1928 1911 1 1. DNS szerkezete Mi az örökítő anyag? Friedrich Miescher

Részletesebben

Budapesti Műszaki és Gazdaságtudományi Egyetem Vegyészmérnöki és Biomérnöki Kar. Hajdú Fanni. BSc. IV. évfolyam Biomérnök szakos hallgató

Budapesti Műszaki és Gazdaságtudományi Egyetem Vegyészmérnöki és Biomérnöki Kar. Hajdú Fanni. BSc. IV. évfolyam Biomérnök szakos hallgató Budapesti Műszaki és Gazdaságtudományi Egyetem Vegyészmérnöki és Biomérnöki Kar Hajdú Fanni BSc. IV. évfolyam Biomérnök szakos hallgató A maláriaellenes célpont Plasmodium falciparum CTP: foszfokolin citidililtranszferáz

Részletesebben

Az örökítőanyag. Az élőlények örökítőanyaga minden esetben nukleinsav (DNS,RNS) (1)Griffith, (2)Avery, MacLeod and McCarty (3)Hershey and Chase

Az örökítőanyag. Az élőlények örökítőanyaga minden esetben nukleinsav (DNS,RNS) (1)Griffith, (2)Avery, MacLeod and McCarty (3)Hershey and Chase SZTE, Orv. Biol. Int., Mol- és Sejtbiol. Gyak., VIII. Az örökítőanyag Az élőlények örökítőanyaga minden esetben nukleinsav (DNS,RNS) (1)Griffith, (2)Avery, MacLeod and McCarty (3)Hershey and Chase Ez az

Részletesebben

Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai

Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai Az áramlási citométer és sejtszorter felépítése és működése, diagnosztikai alkalmazásai Az áramlási citométer és sejtszorter felépítése és működése Kereskedelmi forgalomban kapható készülékek 1 Fogalmak

Részletesebben

A kromoszómák kialakulása előtt a DNS állomány megkettőződik. A két azonos információ tartalmú DNS egymás mellé rendeződik és egy kromoszómát alkot.

A kromoszómák kialakulása előtt a DNS állomány megkettőződik. A két azonos információ tartalmú DNS egymás mellé rendeződik és egy kromoszómát alkot. Kromoszómák, Gének A kromoszóma egy hosszú DNS szakasz, amely a sejt életének bizonyos szakaszában (a sejtosztódás előkészítéseként) tömörödik, így fénymikroszkóppal láthatóvá válik. A kromoszómák két

Részletesebben

A SZIE, MKK GENETIKA ÉS BIOTECHNOLÓGIAI INTÉZETÉNEK EREDMÉNYEI A NÖVÉNYNEMESÍTÉS TUDOMÁNYOKBAN ÉS A NEMESÍTÉS UTÁNPÓTLÁS NEVELÉSBEN

A SZIE, MKK GENETIKA ÉS BIOTECHNOLÓGIAI INTÉZETÉNEK EREDMÉNYEI A NÖVÉNYNEMESÍTÉS TUDOMÁNYOKBAN ÉS A NEMESÍTÉS UTÁNPÓTLÁS NEVELÉSBEN A SZIE, MKK GENETIKA ÉS BIOTECHNOLÓGIAI INTÉZETÉNEK EREDMÉNYEI A NÖVÉNYNEMESÍTÉS TUDOMÁNYOKBAN ÉS A NEMESÍTÉS UTÁNPÓTLÁS NEVELÉSBEN Heszky László és Kiss Erzsébet Keszthely 2013 PARADIGMAVÁLTÁS AZ ÉLETTUDOMÁNYOKBAN

Részletesebben

Imidazolinon-toleráns nem transzgénikus(!) fajták előállítása és termesztése

Imidazolinon-toleráns nem transzgénikus(!) fajták előállítása és termesztése BIOTECHNOLÓGIA OLÓ I ROVATVEZETŐ: Dr. Heszky László akadémikus Az előző részekben a glifozát (Monsanto) és a glufozinát (Bayer) hatóanyagú gyomirtó szerekkel szemben toleráns transzgénikus növények előállítását

Részletesebben

Génmódosítás: bioszféra

Génmódosítás: bioszféra bioszféra Génmódosítás: Nagy butaság volt politikusaink részérôl az alaptalan GMO-ellenesség alaptörvényben való rögzítése. A témával foglalkozó akadémikusok véleménye külföldön és Magyarországon egészen

Részletesebben

BIOTECHNOLÓGIÁK EGYÉB IPARÁGAKBAN. Pókselyemfehérjék előállítása dohányban és burgonyában

BIOTECHNOLÓGIÁK EGYÉB IPARÁGAKBAN. Pókselyemfehérjék előállítása dohányban és burgonyában BIOTECHNOLÓGIÁK EGYÉB IPARÁGAKBAN Pókselyemfehérjék előállítása dohányban és burgonyában Tárgyszavak: selyemfehérje; transzgénikus növény; szintetikus pókselyem; selyemfehérjegén. A Nephila clavipes pók

Részletesebben

10. CSI. A molekuláris biológiai technikák alkalmazásai

10. CSI. A molekuláris biológiai technikák alkalmazásai 10. CSI. A molekuláris biológiai technikák alkalmazásai A DNS mint azonosító 3 milliárd bázispár az emberi DNS-ben (99.9%-ban azonos) 0.1%-nyi különbség elegendő az egyedek megkülönböztetéséhez Genetikai

Részletesebben

1. feladat Összesen: 15 pont. 2. feladat Összesen: 10 pont

1. feladat Összesen: 15 pont. 2. feladat Összesen: 10 pont 1. feladat Összesen: 15 pont Vizsgálja meg a hidrogén-klorid (vagy vizes oldata) reakciót különböző szervetlen és szerves anyagokkal! Ha nem játszódik le reakció, akkor ezt írja be! protonátmenettel járó

Részletesebben

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 NÖVÉNYÉLETTAN Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 Másodlagos anyagcsere termékek a növények védelmében Előadás áttekintése 1. Másodlagos anyagcsere termékek 2. Rovar

Részletesebben

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010

NÖVÉNYÉLETTAN. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 NÖVÉNYÉLETTAN Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 Növényi stresszélettan Előadás áttekintése 1. A növényi stressz, akklimatizáció és adaptáció fogalma 2. A fénytől

Részletesebben

GLUCAGONUM HUMANUM. Humán glükagon

GLUCAGONUM HUMANUM. Humán glükagon 01/2008:1635 GLUCAGONUM HUMANUM Humán glükagon C 153 H 225 N 43 O 49 S M r 3483 DEFINÍCIÓ A humán glükagon 29 aminosavból álló polipeptid; szerkezete megegyezik az emberi hasnyálmirígy α-sejtjei által

Részletesebben

KIS GTP-KÖTŐ FEHÉRJE SZEREPE A NÖVÉNYI CIRKADIÁN ÓRA, STRESSZ-VÁLASZOK ÉS A FÉNYFÜGGŐ ENDOREDUPLIKÁCIÓ SZABÁLYOZÁSÁBAN

KIS GTP-KÖTŐ FEHÉRJE SZEREPE A NÖVÉNYI CIRKADIÁN ÓRA, STRESSZ-VÁLASZOK ÉS A FÉNYFÜGGŐ ENDOREDUPLIKÁCIÓ SZABÁLYOZÁSÁBAN KIS GTP-KÖTŐ FEHÉRJE SZEREPE A NÖVÉNYI CIRKADIÁN ÓRA, STRESSZ-VÁLASZOK ÉS A FÉNYFÜGGŐ ENDOREDUPLIKÁCIÓ SZABÁLYOZÁSÁBAN Doktori (Ph.D.) értekezés tézisei Terecskei Kata Témavezető: Dr. Kozma-Bognár László

Részletesebben

TRANSZGÉNIKUS NIKUS. GM gyapot - KÍNA. GM szója - ARGENTÍNA

TRANSZGÉNIKUS NIKUS. GM gyapot - KÍNA. GM szója - ARGENTÍNA TRANSZGÉNIKUS NIKUS NÖVÉ GM gyapot - KÍNA GM szója - ARGENTÍNA TRANSZGÉNIKUS NIKUS NÖVÉN Élelmezési probléma: mg-i i termények, élelmiszer alapanyagok károsk rosításasa (rovar, gyom, baktérium, gomba,

Részletesebben

Növényi sejtek által előállított monoklonális antitesttöredékek jellemzése

Növényi sejtek által előállított monoklonális antitesttöredékek jellemzése BIOTECHNOLÓGIÁK MŰSZAKI HÁTTERE Növényi sejtek által előállított monoklonális antitesttöredékek jellemzése Tárgyszavak: idegen fehérje; monoklonális antitest; fehérjestabilitás; növényisejt-szuszpenzió;

Részletesebben

TÉMAKÖRÖK. Ősi RNS világ BEVEZETÉS. RNS-ek tradicionális szerepben

TÉMAKÖRÖK. Ősi RNS világ BEVEZETÉS. RNS-ek tradicionális szerepben esirna mirtron BEVEZETÉS TÉMAKÖRÖK Ősi RNS világ RNS-ek tradicionális szerepben bevezetés BIOLÓGIAI MOLEKULÁK FEHÉRJÉK NUKLEINSAVAK DNS-ek RNS-ek BIOLÓGIAI MOLEKULÁK FEHÉRJÉK NUKLEINSAVAK DNS-ek RNS-ek

Részletesebben

SZENT ISTVÁN EGYETEM. Szegfű etilénbioszintézisének antiszensz gátlása almából származó ACC szintáz génnel

SZENT ISTVÁN EGYETEM. Szegfű etilénbioszintézisének antiszensz gátlása almából származó ACC szintáz génnel SZENT ISTVÁN EGYETEM Szegfű etilénbioszintézisének antiszensz gátlása almából származó ACC szintáz génnel Doktori értekezés Veres Anikó Gödöllő 2006. A doktori iskola megnevezése: tudományága: vezetője:

Részletesebben

A glutation peroxidázok szerepének vizsgálata oxidatív stressz esetén lúdfű inszerciós mutánsokban

A glutation peroxidázok szerepének vizsgálata oxidatív stressz esetén lúdfű inszerciós mutánsokban SZEGEDI TUDOMÁNYEGYETEM Természettudományi és Informatikai Kar Növénybiológiai Tanszék DIPLOMAMUNKA A glutation peroxidázok szerepének vizsgálata oxidatív stressz esetén lúdfű inszerciós mutánsokban Investigation

Részletesebben

Biokatalízis, biokonverziók, biotranszformációk Rákhely, Gábor

Biokatalízis, biokonverziók, biotranszformációk Rákhely, Gábor Biokatalízis, biokonverziók, biotranszformációk Rákhely, Gábor Biokatalízis, biokonverziók, biotranszformációk Rákhely, Gábor Publication date 2012 Szerzői jog 2012 Szegedi Tudományegyetem TÁMOP-4.1.2.A/1-11/1

Részletesebben

AZ ÖNEMÉSZTÉS, SEJTPUSZTULÁS ÉS MEGÚJULÁS MOLEKULÁRIS SEJTBIOLÓGIÁJA

AZ ÖNEMÉSZTÉS, SEJTPUSZTULÁS ÉS MEGÚJULÁS MOLEKULÁRIS SEJTBIOLÓGIÁJA TÁMOP 4.1.2.B.2-13/1-2013-0007 ORSZÁGOS KOORDINÁCIÓVAL A PEDAGÓGUSKÉPZÉS MEGÚJÍTÁSÁÉRT MEGHÍVÓ AZ ÖNEMÉSZTÉS, SEJTPUSZTULÁS ÉS MEGÚJULÁS MOLEKULÁRIS SEJTBIOLÓGIÁJA 15 ÓRÁS INGYENES SZAKMAI TOVÁBBKÉPZÉS

Részletesebben

ALMAFAJTÁK MOLEKULÁRIS ELKÜLÖNÍTÉSE ÉS

ALMAFAJTÁK MOLEKULÁRIS ELKÜLÖNÍTÉSE ÉS Szent István Egyetem Gödöllő Növénytudományi Doktori Iskola Doktori Iskola vezetője: Dr. Heszky László Növénynemesítés genetikai és biotechnológiai módszerekkel Programvezető: Dr. Heszky László DOKTORI

Részletesebben

Az Oxidatív stressz hatása a PIBF receptor alegységek összeszerelődésére.

Az Oxidatív stressz hatása a PIBF receptor alegységek összeszerelődésére. Újabban világossá vált, hogy a Progesterone-induced blocking factor (PIBF) amely a progesteron számos immunológiai hatását közvetíti, nem csupán a lymphocytákban és terhességgel asszociált szövetekben,

Részletesebben

A doktori értekezés tézisei. A növényi NRP fehérjék lehetséges szerepe a hiszton defoszforiláció szabályozásában, és a hőstressz válaszban.

A doktori értekezés tézisei. A növényi NRP fehérjék lehetséges szerepe a hiszton defoszforiláció szabályozásában, és a hőstressz válaszban. A doktori értekezés tézisei A növényi NRP fehérjék lehetséges szerepe a hiszton defoszforiláció szabályozásában, és a hőstressz válaszban. Bíró Judit Témavezető: Dr. Fehér Attila Magyar Tudományos Akadémia

Részletesebben

A POLIAMIN ANYAGCSERE JELENT SÉGE AGYDAGANATOKBAN. Egyetemi doktori (Ph.D.) értekezés. Klekner Álmos. Témavezet : Prof. Dr.

A POLIAMIN ANYAGCSERE JELENT SÉGE AGYDAGANATOKBAN. Egyetemi doktori (Ph.D.) értekezés. Klekner Álmos. Témavezet : Prof. Dr. A POLIAMIN ANYAGCSERE JELENT SÉGE AGYDAGANATOKBAN Egyetemi doktori (Ph.D.) értekezés Klekner Álmos Témavezet : Prof. Dr. Csécsei György Debreceni Egyetem Orvos- és Egészségügyi Centrum Idegsebészeti Klinika

Részletesebben

A genomikai oktatás helyzete a Debreceni Egyetemen

A genomikai oktatás helyzete a Debreceni Egyetemen A genomikai oktatás helyzete a Debreceni Egyetemen Bálint Bálint L. GNTP Oktatás és Tudásmenedzsment Munkabizottság, 2009. június 10. Tények Debreceni Egyetemről 21000 nappali és 33000 összes hallgató

Részletesebben

A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei

A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A TM vizsgálatok alapkérdései A vizsgálatok célja, információértéke? Az alkalmazás területei? Hogyan válasszuk ki az alkalmazott

Részletesebben

Real time PCR módszerrel végzett patogén vizsgálatok tapasztalati

Real time PCR módszerrel végzett patogén vizsgálatok tapasztalati Real time PCR módszerrel végzett patogén vizsgálatok tapasztalati Zoller Linda, Rohonczy Kata, Fodor Andrea, Tabajdiné dr. Pintér Vera FoodMicro Kft. Célkitűzés Élelmiszerekben és takarmányokban előforduló

Részletesebben

Gibberellinek. 1. ábra: Gibberellán, gibberellinsav szerkezete. BME Alkalmazott Biotechnológia és Élelmiszertudomány Tanszék 1

Gibberellinek. 1. ábra: Gibberellán, gibberellinsav szerkezete. BME Alkalmazott Biotechnológia és Élelmiszertudomány Tanszék 1 Gibberellinek A japán földmővesek régóta tartottak a rizs növény egy megbetegedésétıl, amit bakanae - nak (bolond palántának) neveztek. A fertızött növény sokkal magasabbra nıtt, mint a többi, ettıl végül

Részletesebben

Németh Anikó 1,2, Kosáry Judit 1, Fodor Péter 1, Dernovics Mihály 1

Németh Anikó 1,2, Kosáry Judit 1, Fodor Péter 1, Dernovics Mihály 1 Németh Anikó 1,2, Kosáry Judit 1, Fodor Péter 1, Dernovics Mihály 1 1 Budapesti Corvinus Egyetem Élelmiszertudomány Kar, Alkalmazott Kémia Tanszék 2 Wessling Hungary Kft., Élelmiszervizsgáló Laboratórium

Részletesebben

KÉMIA 10. Osztály I. FORDULÓ

KÉMIA 10. Osztály I. FORDULÓ KÉMIA 10. Osztály I. FORDULÓ 1) A rejtvény egy híres ember nevét és halálának évszámát rejti. Nevét megtudod, ha a részmegoldások betűit a számozott négyzetekbe írod, halálának évszámát pedig pici számolással.

Részletesebben

A 9,9 -biantril különleges fluoreszcenciája

A 9,9 -biantril különleges fluoreszcenciája A 9,9 -biantril különleges fluoreszcenciája Témavezetők: Demeter Attila és Harangozó József Az oldatok színe attól függ, hogy az oldott molekula a látható színkép mely hullámhossz tartományában nyeli el

Részletesebben

Továbbadása, sokszorosítása írásos engedélyhez kötött.

Továbbadása, sokszorosítása írásos engedélyhez kötött. PÉCSI TUDOMÁNYEGYETEM FELHASZNÁLÓI KÉZIKÖNYV 1. MELLÉKLETE Készítette: A dokumentum kódja: FK-1 Lamár Ibolya 2012. április 2. Kiadás száma: Változat száma: 2 2 Ellenőrizte: Dr. Rékási Zsuzsanna 2012. április

Részletesebben

EGYETEMI DOKTORI (PhD) ÉRTEKEZÉS TÉZISEI NRRL B-2682-ES TÖRZSBEN. Készítette: Dr. Bartalné Deák Eleonóra Biológus, gyógyszerész

EGYETEMI DOKTORI (PhD) ÉRTEKEZÉS TÉZISEI NRRL B-2682-ES TÖRZSBEN. Készítette: Dr. Bartalné Deák Eleonóra Biológus, gyógyszerész EGYETEMI DOKTORI (PhD) ÉRTEKEZÉS TÉZISEI A BÉTA-LAKTAMÁZ ENZIM SZEREPÉNEK ÉS A BÉTA-LAKTÁM ANTIBIOTIKUMOK HATÁSÁNAK VIZSGÁLATA A STREPTOMYCES GRISEUS NRRL B-2682-ES TÖRZSBEN Készítette: Dr. Bartalné Deák

Részletesebben

A proteomika új tudománya és alkalmazása a rákdiagnosztikában

A proteomika új tudománya és alkalmazása a rákdiagnosztikában BIOTECHNOLÓGIAI FEJLESZTÉSI POLITIKA, KUTATÁSI IRÁNYOK A proteomika új tudománya és alkalmazása a rákdiagnosztikában Tárgyszavak: proteom; proteomika; rák; diagnosztika; molekuláris gyógyászat; biomarker;

Részletesebben

klorid ioncsatorna az ABC (ATP Binding Casette) fehérjecsaládba tartozik, amelyek általánosságban részt vesznek a gyógyszerek olyan alapvetı

klorid ioncsatorna az ABC (ATP Binding Casette) fehérjecsaládba tartozik, amelyek általánosságban részt vesznek a gyógyszerek olyan alapvetı Szegedi Tudományegyetem Farmakológiai és Farmakoterápiai Intézet Igazgató: Prof. Dr. Varró András 6720 Szeged, Dóm tér 12., Tel.: (62) 545-682 Fax: (62) 545-680 e-mail: varro.andras@med.u-szeged.hu Opponensi

Részletesebben

Emberi szövetek. A hámszövet

Emberi szövetek. A hámszövet Emberi szövetek Az állati szervezetekben öt fı szövettípust különböztetünk meg: hámszövet, kötıszövet, támasztószövet, izomszövet, idegszövet. Minden szövetféleség sejtekbıl és a közöttük lévı sejtközötti

Részletesebben

Transzgénikus növények előállítása

Transzgénikus növények előállítása Transzgénikus növények előállítása Növényi biotechnológia Területei: A növények szaporításának új módszerei Növényi sejt és szövettenyészetek alkalmazása Mikroszaporítás Vírusmentes szaporítóanyag előállítása

Részletesebben

Molekuláris biológiai technikák

Molekuláris biológiai technikák Molekuláris biológiai technikák Wunderlich Lívius A Molekuláris biológiai technikák jegyzet igyekszik átfogó képet adni a jövő tudományának, a molekuláris biológiának a módszertanáról. A technikák elméleti

Részletesebben

Tárgyszavak: hemofilia; terápia; vértranszfúzió; vérplazma; krioprecipitátum; VIII. faktor; tisztítás; rekombináns DNS-technika; génterápia.

Tárgyszavak: hemofilia; terápia; vértranszfúzió; vérplazma; krioprecipitátum; VIII. faktor; tisztítás; rekombináns DNS-technika; génterápia. BIOTECHNOLÓGIA AZ EGÉSZSÉGÜGYBEN A hemofilia kezelésének fejlődése a transzfúziótól a génterápiáig Tárgyszavak: hemofilia; terápia; vértranszfúzió; vérplazma; krioprecipitátum; VIII. faktor; tisztítás;

Részletesebben

Lehet!ségek gombabetegségeknek ellenálló GM búza el!állítására

Lehet!ségek gombabetegségeknek ellenálló GM búza el!állítására Lehet!ségek gombabetegségeknek ellenálló GM búza el!állítására Jenes Barnabás, Várallyay Éva, Tóth Gábor, Ivanics Milán, Giczey Gábor, Balogh Andrea, Oreifig S. Aid, Burgyán József Mez!gazdasági Biotechnológiai

Részletesebben

ORGANIKUS GAZDÁLKODÁS BIOLÓGIAI ALAPJAINAK BIOANALITIKAI VIZSGÁLATA AZ ÉSZAK-ALFÖLDI RÉGIÓT JÓL REPREZENTÁLÓ FAJTÁK TEKINTETÉBEN

ORGANIKUS GAZDÁLKODÁS BIOLÓGIAI ALAPJAINAK BIOANALITIKAI VIZSGÁLATA AZ ÉSZAK-ALFÖLDI RÉGIÓT JÓL REPREZENTÁLÓ FAJTÁK TEKINTETÉBEN ORGANIKUS GAZDÁLKODÁS BIOLÓGIAI ALAPJAINAK BIOANALITIKAI VIZSGÁLATA AZ ÉSZAK-ALFÖLDI RÉGIÓT JÓL REPREZENTÁLÓ FAJTÁK TEKINTETÉBEN EA_NORVÉGALAP-BIOBEL9 BIO/NEM BIO AGRÁRTERMÉKEK BELTARTALMI ÉRTÉKEINEK ÖSSZEHASONLÍTÁSA

Részletesebben

MŰANYAGOK ALKALMAZÁSA

MŰANYAGOK ALKALMAZÁSA MŰANYAGOK ALKALMAZÁSA Fenntartható anyagok alkalmazása a kertészetben A bioműanyagok egyik kitörési pontja lehet, az ún. többfunkciós anyagok fejlesztése, amikor több alkotórész pozitív jellemzőinek kombinálásával

Részletesebben

AZ EMBERI MIKROBIOM: AZ EGYÉN, MINT SAJÁTOS ÉLETKÖZÖSSÉG Duda Ernő

AZ EMBERI MIKROBIOM: AZ EGYÉN, MINT SAJÁTOS ÉLETKÖZÖSSÉG Duda Ernő AZ EMBERI MIKROBIOM: AZ EGYÉN, MINT SAJÁTOS ÉLETKÖZÖSSÉG Duda Ernő Az NIH, az Egyesült Államok Nemzeti Egészségügyi Hivatala (az orvosi- és biológiai kutatásokat koordináló egyik intézmény) 2007 végén

Részletesebben

Mezőgazdasági növénybiztosítás

Mezőgazdasági növénybiztosítás Mezőgazdasági növénybiztosítás Különös biztosítási feltételek 1/40 AHE-11536 Tartalomjegyzék 1. Általános rendelkezések... 3 1.1. A biztosítás tárgya, területi és időbeli (kockázatviselési ) hatálya...

Részletesebben

3. HPV típusok meghatározása RFLP analízissel, típus-specifikus PCR módszerrel és blot assay módszerrel.

3. HPV típusok meghatározása RFLP analízissel, típus-specifikus PCR módszerrel és blot assay módszerrel. OTKA zárójelentés 2007 Részletes összefoglaló Célkitűzések: 1. Human papillomavirusok (HPV) kimutatása colorectalis daganatok miatt eltávolított biopszia mintákból nukleinsav hybridizációs próbával. 2.

Részletesebben

A mutáns fenotípushoz szorosan kapcsolt markerek (1N1R és U212D) segítségével BAC (Bacterial Artifical Chromosome) klónokat azonosítottunk egy másik

A mutáns fenotípushoz szorosan kapcsolt markerek (1N1R és U212D) segítségével BAC (Bacterial Artifical Chromosome) klónokat azonosítottunk egy másik A szimbiotikus gümő kialakulásában résztvevő két gén azonosítása Medicago truncatulaból térképezésen alapuló génizolálással c. OTKA pályázat (T046645) zárójelentése A pályázat célja a Sinorhizobium meliloti

Részletesebben

SZENT ISTVÁN EGYETEM. Szegfű etilénbioszintézisének antiszensz gátlása almából származó ACC szintáz génnel

SZENT ISTVÁN EGYETEM. Szegfű etilénbioszintézisének antiszensz gátlása almából származó ACC szintáz génnel SZENT ISTVÁN EGYETEM Szegfű etilénbioszintézisének antiszensz gátlása almából származó ACC szintáz génnel Doktori értekezés tézisei Veres Anikó Gödöllő 2006. A doktori iskola megnevezése: tudományága:

Részletesebben

Belső hasznosítás. Kémiai struktúra. Fibersol-2

Belső hasznosítás. Kémiai struktúra. Fibersol-2 Fibersol-2 A Fibersol-2 egy egyedülállóan oldódó étkezési rost melyet keményítőből állítanak elő dexrtinizációs és enzimes eljárások kombinációjával. A Fibersol-2 jól működő szerteágazó kémiai struktúrával

Részletesebben

2. A MIKROBÁK ÉS SZAPORÍTÁSUK

2. A MIKROBÁK ÉS SZAPORÍTÁSUK 2. A MIKROBÁK ÉS SZAPORÍTÁSUK A biológiai ipar jellemzően mikroorganizmusokat, vagy állati és növényi szervezetek elkülönített sejtjeit szaporítja el, és ezek anyagcseréjét használja fel a kívánt folyamatok

Részletesebben

Az Egészségügyi Minisztérium módszertani levele Immunhisztokémiai és immuncitokémiai módszerek alkalmazása a patológiában

Az Egészségügyi Minisztérium módszertani levele Immunhisztokémiai és immuncitokémiai módszerek alkalmazása a patológiában 1 Az Egészségügyi Minisztérium módszertani levele Immunhisztokémiai és immuncitokémiai módszerek alkalmazása a patológiában Készítette: Az Országos Pathologiai Intézet és a Pathologus Szakmai Kollégium

Részletesebben

A sejtek lehetséges sorsa. A sejtek differenciálódása. Sejthalál. A differenciált sejtek tulajdonságai

A sejtek lehetséges sorsa. A sejtek differenciálódása. Sejthalál. A differenciált sejtek tulajdonságai A sejtek lehetséges sorsa A sejtek differenciálódása, öregedése Sejthalál osztódás az osztódási folyamatok befejezése és specializálódás egy (összetett) funkra: differenciá elöregedés (szeneszcencia) elhalás

Részletesebben

Sejttenyésztési alapismeretek

Sejttenyésztési alapismeretek Sejttenyésztési alapismeretek 1. Bevezetés A sejteknek ún. sejtkultúrákban történő tenyésztése (a sejteket az eredeti helyükről eltávolítva in vitro tartjuk fenn ill. szaporítjuk) és tanulmányozása több

Részletesebben