Méret: px
Mutatás kezdődik a ... oldaltól:

Download ""


1 AFP (α-fetoprotein) Biokémiai adatok Az α-fetoprotein (AFP) onkofetális fehérje, egy egyláncú α-globulin aminosavból és egy szénhidrát láncból álló glikoprotein 9,10,11. A magzati keringésben a 6. héten jelenik meg 3. A 12. terhességi hétig a csírazsák, ezt követően (annak degenerációja után) a fetalis máj termeli 1. Az AFP az extracelluláris mátrixban (ECM), a sejtfelületen, a receptoszómákban, az endoplazmatikus retikulumban (ER) és a citoplazmában perinukleárisan lokalizált 16,17,32. A magzati AFP-termelés a csúcsát (a 40 mg/l koncentrációt 3 ) a 14. héten éri el, ezt követően szintézise a szülésig csökken 2, születés után koncentrációja 30µg/l-re esik, a normál felnőttkori szintet (2-10 ng/ml) 1 éves kor végére éri el 4. Azt a megfigyelést, hogy az AFP termelés nem szűnik meg a megszületéskor, azzal magyarázzák, hogy átmenetileg a megmaradt fetalis hepatocyták termelik 2. Az újszülött szérum AFP szintje a felnőtt referencia tartomány négyszeresét is meghaladhatja 2,5-7 és születési súllyal korrelációt mutat 1. Az amnion folyadék a magzati szérum AFP koncentráció tükrének tekinthető, mivel a magzati AFP ide exkretálódik. Az anyai szérum AFP szintje jóval alacsonyabb, s a terhesség 32. hetéig emelkedik. Az AFP génje a négy tagból (albumin, D-vitamin-kötő protein, AFP és α-albumin más néven afamin) álló albuminoid géncsalád tagja 21,22. Ezek a gének egymást követően helyezkednek el a 4q11-q22 régióban, 15 exont és 14 intront tartalmaznak 23. Mindegyik említett fehérje három doménből álló, U-alakú molekula. Szénhidrát oldallánc A humán α-fetoprotein szerkezete. A szaggatott nyíl jelzi a hinge ( csukló ) régiót, ahol nincs diszulfid híd (9 alapján) Dr. Krkos Károly V

2 AFP receptorok Négy membrán receptor ismert. Ezek zömmel endothelialisan, vagy az epithelialis sejtfelszínen találhatók 17 20, de kimutattak AFP-receptorokat monocyták, reproduktív és tumor sejtek felszínén is Feltehetően nemcsak a natív AFP molekulát képesek kötni, hanem annak különböző variánsait is. Genetikai variánsok A fő fetalis és tumorból származó AFP mrns 2,2 kilobázisú transzkript, mely szénhidrát tartalmától függően dalton molekulatömegű fehérjévé transzlálódik 25,26, de emellett létezik, 1,35 kilobázisú mrns-ből származó transzkript is, mely intracellulárisan marad. Az intakt molekulához képest ebben a teljes 1. domén és a második domén 1/3-a hiányzik, továbbá nem tartalmaz szénhidrátot. Ez a variáns normál humán AFP mintegy 40%-át teszi ki. Szteroid receptorokhoz képes kötődni 30. A 3. domén hidrofób kötőhelyeket tartalmaz, dimerizációra hajlamos 27,30, más intracelluláris fehérjékkel is képes heterodimert alkotni 28,29. Szabad és kötött molekuláris formák Az AFP szabad és különféle petidekhez (IgG, IgM, aktin, TGF-β, osteonectin, proteáz szubsztrátok és inhibitorok) kötött formában fordul elő 27, emellett dimer-afp-t is kimutattak (in vivo) 31. AFP fragmentumok A plazma proteinek,- így az albumin és az AFP is biológiai válasz-módosító peptid fragmentumok rezervoárjának is tekinthetők. Mindkét molekulában találhatók rövid aminosav-szekvenciák, melyek a neurotenzin és a neuromedin hasadási termékeivel mutatnak nagy hasonlóságot 42 (kinetensin-like segments), de egyéb biológiailag aktív peptid szegmentjének aminosav-szekvenciája is fellelhető a humán AFP molekulában (insulin-like 43, EGF-like 44,45, plasminogen activator-like 27,41, growth inhibitory peptid 33,40, hisztokompatibilitási 38,39 szegment). Ezek mellett a zsírsavkötő 66,74 és az ösztrogénkötő 129,130 helyet is azonosították. A humán AFP aminosav sorrendje és az egyes fragmentumok biológiai aktivitása ABS: aktin-kötő hely, ARP: apoptosisrelated peptid, BBS 1,2: bilirubin-kötő helyek, EBS: ösztrogén-kötő hely, EGFL: EGF -szerű szegment, FBS: zsírsav-kötő helyek, GIP: növekedés-gátló peptid, HCS histocompatibilitási (class II) szegment, HMS 1, 2: nehézfém-kötő hely, ILS: inzulinszerű szegment, KLS: kinesin szerű szegment, LPH: leucine predicted heptads, L-A: laminin-a szegment, L-B1: laminin-b1 szegment, LRE (leu-arg-glu), LDV (leu-aspval) és RGD (arg-gly-asp): sejt-adhéziós szekvenciák, MPS: tej-kazein peptid szegment, NAI: non-albumin identikus szegment, PAS: plazminogén aktivátor szegment, PRS: prolin-gazdag szegment, RBS: humán AFP receptor-kötő hely, SRGD: reverz RGD szegment, ZBS: cinkkötő hely (27, 33, 40, 43-50, 51, 52 alapján) Dr. Krkos Károly V

3 Az AFP molekuláris mikroheterogenitása Szénhidrát izoformák Az albuminnal ellentétben a humán AFP 2. doménjén egy, a 232 aszparaginhoz kapcsolt, N-kötött glikánt tartalmaz. A hepatoma sejtekben termelt AFP glikánjának struktúrája különbözik a csírazsák daganatokéban találtaktól 11, ugyanakkor a két molekula variánsban az aminosav-sorrend megegyezik. Ezeket a szénhidrát komponensükben különböző formákat lektinkötésük alapján el lehet különíteni. A leggyakrabban alkalmazott lektin a Lens culinaris agglutinin (LCA), mely a hepatocellularis carcinomára (HCC) jellemző AFP-t köti. Ez a lektin akkor kapcsolódik nagy affinitással az AFP kettős ágú szénhidrát láncával, ha az aszparaginhoz csatolt glikozil-n-acetil (GlcNAc) egy fukózt tartalmaz 1-6 kötésben 12, 73. Az AFP-L3 szénhidrátlánca A galaktóz-specifikus Ricinus communis agglutinin-1 (RCA) akkor köti az AFP-t ha annak kétágú glikánjában az utolsóelőtti helyen galaktóz található 72. Lektin típus Concanavalin A (ConA) Lens culinaris agglutinin (LCA) Ricinus communis agglutinin-1 (RCA) Phaseolus vulgaris erytroagglutinin Cukor specificitás d-mannóz 2 Detektált izoformák száma Klinikai használat PRG, HCC, MHC, YST Irodalom 118,119 d-mannóz (l-fukóz) 2 HCC, MHC, LCH, BLD 73, 118 d-galaktóz 3 HCC, YST 68 Komplex kettőságú glikán 5 HCC, MHC, YST 124, 125 PRG: terhességi izoformák, HCC: primer hepatocellularis carcinoma, MHC: metastaticus hepatocellularis carcinoma (májon kívüli áttéttel), LCH: cirrhosis hepatis, BLD: benignus májbetegség, YST: csírazsák tumor A lektinek nemcsak egyes szénhidrát-csoportra specifikusak, hanem az egész szénhidrát-molekulára. A szénhidrát lánc összetétele nem kódolt genetikailag, annak szintézisében az endoplazmatikus retikulumban (ER) és a Golgi apparátusban lévő glikozilációs enzimek játszanak szerepet. Ezek az enzimek szövet-specifikusak, így a glikán összetétele is szövetspecifikus 68-71, ennek következtében más a szénhidrát-összetétele a máj- és a csírazsák-eredetű AFP-nek. Az amnion-folyadékban található AFP a két említett típus keveréke, melyben a két típus aránya a gesztációs kortól függ. A különböző lektin-affinitáson alapuló módszerek kombinációjával (pl. crossed affinity immonoelectrophoresis) legalább 10 glikoforma különböztethető meg 67. ph izoformák Izoelektromos fókuszálással két fő izoformát lehet megkülönböztetni (izoelektromos pont ph 4,8 és ph 5,2), melyről kiderült, hogy ezeket zsírsavtartalmuk különbözteti meg 74, 75 : a ph4,8 izoelektromos pontú variáns 2,4 mol zsírsavat tartalmaz, míg ph 5,2 izoelektromos pontú nem tartalmaz zsírsavat. Köldökzsinórvér AFP izokromato-fókuszálásával három különböző izoelektromos pontú fromát eluáltak 76 az oszlopról: ph4,5 (52%), ph 4,7 (43%) és ph<4,0. A ph-tól függően konformáció változások figyelhetők meg az AFP molekulán 77. Neutrális ph-n a molekulafelszín hidrofil és a hidrofób szegmentek rejtve maradnak. Dr. Krkos Károly V

4 Denaturált intermedierek és az MGF Az intracelluláris kompartmentek változó környezetében a fehérjemolekula enyhén denaturált (unfolded) állapotban lehet, melyet molten globule formának (MGF) neveznek 32. Ezt a fehérje harmadik termodinamikai állapotának 32,92 tartják, mely a harmadlagos szerkezet kialakulásának kinetikai köztes állapota 92. Ennek a formának számos élettani aktivitásban (fehérje transzlokáció, membránba történő insertio, hősokk fehérjék felismerése és az azokkal történő kapcsolódás, lysosomalis protein degradáció) szerepet tulajdonítanak. Laboratóriumi vizsgálatok igazolják, hogy az AFP konformációját mikrokörnyezeti változások [pl. hidrofób ligandumok (ösztrogének, zsírsavak) szérumkoncentrációjának megemelkedése] módosítják 34,79,80. Az AFP MG állapotában megtartja natív másodlagos szerkezetét, ugyanakkor a molekula kevésbé rigiddé válik, mint az a natív harmadlagos szerkezetre jellemző, s egyes rejtett csoportjai hozzáférhetők lesznek, így a hidrofób alifás és aromás oldalláncok, melyek a natív állapotban rejtettek. Feltehetően a fehérjék MG formát vesznek fel, mikor töltött felszínt vagy membránt közelítenek meg 32,91. Amint átjutnak a membránon visszanyerik natív formájukat. Az MG forma tehát szerepet játszik a fehérje adherenciában, transzlokációban, bilipid membránfelületbe ékelődésben 32. A humán AFP natív és MG állapotának sematikus ábrázolása (32,78-80, 89, 90, 92, 94 alapján NATÍV AFP AFP MGF A) kompakt szerkezet A) kevésbé tömör forma B) merev szerkezet B) flexibilis szerkezet C) rejtett oldalláncok C) hozzáférhető oldalláncok D) mozdulatlan izomer D) rotációra képes izomer E) Zárt hurkok E) kinyíló hurkok Denaturáló állapot lehet a hypoxia, a ph, az ozmózis kifejezett változása, glükóz- és hősokk, magas ligandum (pl. ösztrogén) koncentráció. A ligandummal telített AFP interakciója a sejtfelületi receptorral konformációváltozást okoz, mely az AFP-ligandum komplex disszociációjával jár. A ligand ezután transzlokálódik a közeli ligand- akceptor helyre. A ligand- mentes AFP leválik a receptorról és endocytosissal a sejtbe jut 32,93. Dr. Krkos Károly V

5 A molekuláris chaperonok szerepe Az MGF kialakulásával molekulafelszínen hozzáférhetővé váló non-poláris molekularészek lehetővé teszik a hő-sokk proteinekkel történő kapcsolódást 94,95. Közvetlen bizonyíték van arra, hogy a chaperoninok elősegítik a naszcens polipeptid lánc korrekt harmadlagos szerkezetének (a protein folding) kialakulását 96. A chaperoninok meggátolják, hogy a folding ne a megfelelő időben és ne a megfelelő sejt lokalizációban történjen. A chaperoninok közé nemcsak a hő-sokk és glükóz-sokk fehérjék (HSP90, HSP70, HSP60 és BiP) tartoznak, de a co-chaperoninok, kalcium-kapcsolt proteinek (calnexin, calmodulin) és két enzim (a protein-diszulfid izomeráz és a peptidil-prolil izomeráz) is 96,97. A chaperoninok nem enzimként működnek és nem gyorsítják a fehérjék harmadlagos szerkezetének kialakulását, hanem elősegítik a folding korrekt menetét, meggátolják az újonnan szintetizálódott polipeptid láncok non-specifikus aggregációját. A chaperoninok segítenek a fehérjék hő- és egyéb sokkhatást követő túlélésében és reparálódásában 98,99. Mivel az MG forma hajlamos az aggregációra, a chaperoninok meggátolják az MGF molekulák összecsapódását, stabilizálják ezt az állapotot, inkább késleltetik, mint gyorsítják a folding folyamatát 99,100. Celluláris adhéziós szekvenciák az AFP molekulában Az AFP 2. doménjén extracelluláris mátrix (ECM) proteinekkel közös rövid peptid szekvenciákat találtak (celluláris adhéziós motívumok, CAMs). Számos tanulmány kimutatta, hogy a CAM felismerési szignál kritikus biológiai aktivitások sorát modulálja Az ECM fehérjecsalád tagjai (laminin, fibronektin, kollagén, vitronektin, thrombospondin stb.) adhéziós makromolekulák 47, melyek szerepet játszanak a fejlődésben, és a növekedéssel, differenciálódással, sejtmigrációval, daganat áttétképződéssel kapcsolatos állapotokban. Néhány CAM sejtdifferenciálódást, tumornövekedést, angiogenezist blokkoló hatású. Az ECM molekulák egy része (laminin, kollagén, fibronektin) olyan multiplex, biológiailag aktív peptid szekvenciákat tartalmaz, mely hatása sejttípustól függően változó 95. Az AFP-ben található ezekkel egyező szekvenciák arra utalnak, hogy az AFP is játszhat hasonló szerepet, mint az adhéziós molekulák 27. Az AFP feltehetőleg a fejlődő szervezet szerkezeti interstitialis útvonalainak finom beállításában működik közre. Érdekes, hogy ugyancsak a 2. doménben, a non-cam aktív régióban található a zsírsav 27,65,66 - és a bilirubin-kötő hely. Az ECM fehérjékben és a humán AFP-ben található sejt-adhéziós szekvenciák (CAM-ok) A molekula neve / a kezdő szekvencia az AFP-ben Laminin-S/ 197 Fibronektin/ 241 Fibronektin/ 252 Kollagén I és IV/ 261 Laminin B1/ 268 Laminin B1/ 309 Aminosavfelismerő szekvencia Leu-Arg-Glu / Leu-Arg-Glu Leu-Asp-Val / Leu-Asp-Val Arg-Gly-Asp / Cys-Arg-Gly-Asp Asp-Gly-Glu-Ala / Asp-Gly-Glu-Lys Tyr-Ile-Gly-Ser-Arg / Tyr-Ile-Cys-Ser-Gln Pro-Asp-Ser-Gly- Arg / Pro-Asn-Leu-Asn- Arg Feltételezett funkció Elősegíti a ciliaris ganglionok adhézióját 47 Elősegíti a a velőcső sejtek és a lymphocyták adhézióját és szóródását Elősegíti a sejt-adhéziót, gátolja a daganatáttét képződést, csökkenti a thrombocyták fibrinogénhez történő tapadását, befolyásolja az angiogenezist Blokkolja a thrombocyták kollagénhez (de nem a fibronektinhez és lamininhoz) történő tapadását, gátolja a ráksejtek adhézióját a kollagénhez Nem reagál a neuralis sejtekkel, gátolja a tumor áttétképződést (a növekedést és az angiogenezist),és elősegíti a sejtmigrációt Gátolja a chorio-allantoin membránon a tumor növekedést és áttétképződést, angiogenezist Irodalom 54,55 52, 53, 55, 60, 61 63, 64 49, 58, Dr. Krkos Károly V

6 Kevert RGD/ 316 Laminin A/ 351 Leu-Gly-Asp-Arg / Leu-Gly-Asp-Arg Ser-Ile-Lys-Val-Ala- Val/ Ile-Leu-Arg-Val-Ala- Lys RGD (Arg-Gly-Asp) antagonista / inhibitor; MHC Class II rokon A neuralis sejtekkel reagál, fokozza a daganatáttét képződést, a plazminogén aktivációt és a kollagenáz aktivitást Az AFP élettani szerepe Mint az albominoid géncsalád többi tagja, az AFP is ligand transzport funkcióval rendelkezik, de ezenkívül számos egyéb folyamatban is szerepet játszik: kemotaxis, eszteráz aktivitás, oxigén szabadgyök eltávolítás, leukocyta adherencia, réz-stimulálta lipid peroxidáció, zsírsav-, nehézfém-, aktin-kötés Ligandumok kötése és transzportja az AFP egyik fő feladat a magzati fejlődés során. Az AFP nemcsak magzati/anyai molekulákat képes megkötni, hanem a populációra nézve jelentős, környezetből származó molekulákat is (fito-ösztrogének, flavonoidok, dioxin-származékok 106 ) Az AFP mint növekedés regulátor Az AFP egy onko-fetalis fehérje, mely elősegíti a növekedést különböző in vitro (sejt) és in vivo (állat) modellekben 11,27,107. Feltehetően alapvető szerepe van a terhesség normális lefolyásában. Mint autokrin faktor viszont elősegítheti különböző daganatok növekedését bizonyos koncentrációban és bizonyos körülmények között 107, , ugyanakkor az AFP és az abból származó peptidek gátolni is képesek a proliferációt 11,27,39. Az AFP tehát a növekedés kettős regulátora, képes mind fokozni, mind gátolni azt 65,108, A növekedés és differenciálódás up- és down- modulációja dózisfüggő ,128. Az AFP a növekedést számos mechanizmuson keresztül képes szabályozni: apoptosis reguláció, citoplazma szignál moduláció, receptor deszenzitizáció. Az AFP-mediálta apoptozis Ca 2+ - és tirozinkináz-independens úton valósul meg, nem igényel proteinés/vagy RNS-szintézist 121 és intakt TNF-receptort 123. Az AFP apoptosist képes indukálni caspase-3 aktivációjával, a FAS és TNF receptor dependens szignál kikerülésével 124,125, az iniciátor caspase-1,8 és-9 aktiválásától függetlenül 50,126. IL-2 és más immunregulátoros szerek képesek viszont ezt hatást felfüggeszteni 122. Az AFP nagy dózisban (>100µg/ml) képes különböző tumorsejtek növekedését gátolni 127, kis dózisban viszont ez a hatás elmarad. Az AFP ösztradiol-indukálta konformáció változása az MCF-7 emlőrák-sejtek növekedésének további szignifikáns szuppresszióját okozta 127. Az AFP meghatározás klinikai jelentősége Mivel az AFP onkofetalis fehérje, szérumkoncentrációjának meghatározását elsősorban bizonyos daganatok nyomon követésére valamint fejlődési rendellenességek szűrésére használják. Az AFP mint tumor marker Az AFP-t főként endodermalis sinus (régebbi elnevezés szerint csírasejt) tumorok és a hepatocellularis carcinoma stádium besorolására, nyomon követésére, prognózisának megállapítására használják. Felnőttkori referencia tartománya: 2 10 ng/ml. Felezési ideje a szérumban: 5 nap 4. A szérum AFP számos nem rosszindulatú betegségben is emelkedett lehet: vírus hepatitis, krónikus aktív hepatitis, postnecroticus és primer biliaris cirrhosis, tyrosinaemia, ataxia teleangiectasia 4. Specifikusabb, érzékenyebb a hepatocellularis carcinoma kimutatására az AFP-L3 glikoforma arányának meghatározása, mely Lens culinaris aggluitinint (LCA) alkalmazó 12,13 lektin-affinitás elektroforézissel lehetséges. Dr. Krkos Károly V

7 Az AFP glikoformák és klinkai jelentőségük Glikoforma Affinitása a LCA-hez Klinikai jelentősége AFP-L1 alacsony Krónikus gyulladásos májbetegségek AFP-L2 átmeneti Csírasejt tumorok, májáttétek AFP-L3 magas Hepatocellularis carcinoma Az AFP L-3% cut-off értéke: 10% Jelenleg az AFP, az AFP-L3% és a DCP [dez-γ-karboxi-protrombin, régi nevén PIVKA-II (protein induced by vitamin K absence)] együttes meghatározása jelenti a legszenzitívebb módszert a hepatocellularis carcinoma monitorozására 14. Az anyai szérum AFP vizsgálata Kromoszóma számbeli rendellenességek esetén (elsősorban Down szindrómában és Edwards szindrómában 146 ) a normális terhességhez képest szignifikánsan alacsonyabb AFP-szint mérhető a terhesség második trimeszterében. Az AFP önmagában nem elég megbízható a szűrésre, azt további két (hcg és nem-konjugált ösztriol, tripla teszt ,139 ) vagy három (előbbi kettő +inhibin A, négyes teszt 138 ) paraméterrel kiegészítve megfelelő hatékonyságú szűrőteszt áll rendelkezésre. A kockázatbecslést megfelelő statisztikai programmal kell végezni. A programok nem a paraméterek közvetlen koncentrációját használják, hanem azoknak az adott gesztációs korra meghatározott mediánjára normált értékét (a multiples of the median-t, MoM-t). A paraméterek mediánját nemcsak a gesztációs kor befolyásolja, hanem az anyai testsúly 135, a dohányzás 135, az anya esetleges diabétesze (csak az IDDM) 136, etnikai hovatartozása 134, előző Down terhesség 134, ikerterhesség 134. Mindezeket a tényezőket általában figyelembe veszik a ma használatos programok. A tripla teszttel 69%-os a négyes teszttel 76% detektálási ráta (DR) érhető el 5% fals-pozitív arány (FPR) mellett 134. Down szindrómában az Alzheimer kórhoz (AZD) hasonlóan amyloid fibrillumok akkumulálódnak az agysejtekben 102. AZD-ben a HSP70 fokozott szintézisét és akkumulációját észlelték 103, s arra a következtetésre jutottak hogy rossz harmadlagos szerkezetű (misfolded) chaperon keletkezhet 104. A proamyloid prekurzor génje a 21-es kromoszóma hosszú karján található, amely triplikált formában van jelen Down kórban. Úgy tartják, hogy ennek a génnek az overexpressziója vezet az emelkedett proamyloid/amyloid képződéshez, felszaporodásuk az endoplazmatikus retikulumban pedig stressz szignált jelent és a hő-sokk gének aktivációját eredményezi 105. Általában a fehérjék mintegy 1%-ának nem megfelelő a harmadlagos szerkezete 131. Amennyiben chaperonint érint a misfolding, más fehérjék (így az AFP) nem megfelelő harmadlagos szerkezetű variánsának aránya megnő (akár 20% is lehet 101 ). A misfolded AFP feltehetőleg nem immunoreaktív, immunoassay módszerekkel nem detektálható, így alacsonyabb AFP szint mérhető Emelkedett az anyai AFP-szint a második trimeszterben a magzat velőcső záródási rendellenessége esetén Egy Nagy-Britanniában végzett kollaboratív tanulmány 141 alapján, ha az AFP MoM érték 2,5 és e feletti, 85% detektálási rátával és 1,4% fals-pozitív aránnyal szűrhetők az ebbe a körbe tartozó fejlődési rendellenességek (cranialis málformációk: anencephalia, encephalocele, craniorachischisis totalis, spinalis megjelenési formák: spina bifida aperta, myelomeningocele, meningocele, myeloschisis, lypomyelomeningocele, nyitott gerinc málformációk, diastematomyelia, diplomyelia, caudalis agenesis). Amennyiben az emelkedett anyai szérum- AFP- szint alapján kiszűrt terhesség szonográfiás vizsgálatakor nem dönthető el biztosan, van-e velőcső-záródási rendellenesség, az amnion folyadék AFP és acetilkolin-eszteráz (AChE) vizsgálata megerősíti a diagnózist 143,144. (Emelkedett AChE aktivitás és 2 AFP MoM: 99% DR és 0,3% FPR.) A magasabb AFP szint a placentalis dysfunctio indikátora is lehet, nem-várt halva-szülést jelezhet és közvetlen összefüggést mutat a hirtelen újszülöttkori halál szindróma (sudden infant death syndrome, SIDS) rizikójával 8. Dr. Krkos Károly V

8 IRODALOM 1. Bellini C, Bonacci W et al.: Clin Chem (12): Blair JI, Carachi R et al.: Arch Dis Child : Liu FJ, Nakamura RM et al. In Cancer Diagnostics (ed. by RN Nakamura, WW Grody, JT Wu RB Nagle- Humana Press, Totowa, New Jersey) p Liu FJ, Nakamura RM et al. In Cancer Diagnostics (ed. by RN Nakamura, WW Grody, JT Wu RB Nagle- Humana Press, Totowa, New Jersey) p Blohm ME, Vesterling-Hörner D et al.: Pediatric hematology and oncology (2): Ohama K, Nagase H et al.: Eur J Ped Surg (5): Bader D, Riskin A et al.: Clin Chim Acta (1-2): Gordon CS, Smith MD et al.: NEJM (10): Morinaga T, Sakai M et al.: Proc. Natl. Acad. Sci USA : Yang F, Luna VJ et al.: Nucleic Acids Res : Mizejewski GJ: Crit Rev Eukaryot Gene Expr : Li D et al.: Clin Chim Acta (1-2): Khein VV et al.: In J Biol Markers (2): Lamerz L et al.: Anticaner Res : Mizejewski GI: J Theor Biol : Torres JM, Anel A et al.: J Cell Physiol : Naval J, Villacampa MJ et al.: Proc Natl Acad Sci USA : Torres JM Caracq N et al.: Biochem Biophys Acta : Suzuki Y, Zeng CQY et al.: J Clin Invest : Moro R Tamaoki T et al.: Tumor Biol : McLeod JF, Cooke NE: J Biol Chem : Lichtenstein HS Lyons DE et al.: J Biol Chem : Smith CJP, Kelleher PC: Biochim Biophys Acta : Mizejewski GJ: Proc Soc Exp Biol Med : Petropoulus C, Andrews G et al.: J Biol Chem : Petropoulus C, Yaswen P et al.: Cancer Res : Belanger L, Roy S et al: J Biol Chem : Seal W, Hanstein B et al.: Mol Endocrinol : Resnick EM Schreihofer DA et al.: J Biol Chem : Mizejewski GJ Bioessays : Goncharova O, Didich E et al.: Tumor Biol : Bychkova VE, Ptitsyn OB: Chemtracts, Biochem Mol Biol : Butterstein GM, Mizejewski GJ: Comp Biochem Physiol A: Hsourigui M, Thabie N et al.: Biochim Biophys Acta : Smalley JR, Sarcione EJ: Biochem Biophys Res Commun : Sarcione EJ, Zlotty M et al.: Cancer Res : Sarcione EJ, Hart D: Int J Cancer : Vollner CM, Eilber FC et al.: Cancer Res : Butterfield LH, Koh A et al.: Cancer Res : Mizejewski GJ: Life Sci : Campbell ID, Bork P.: Curr Opin Struct Biol : Carroway RE, Mitra SP J Biol Chem : Terentiev AA, Tagirova AK et al.: Tumor Biol : Salmasi JM, Kazimirski AN et al.: Tumor Biol : Terentiev AA, Tatarinov YS: Tumor Biol : Mizejewski GJ, Dias JE et al.: Mol Cell Endocrinol : Yamada Y, Kleinmann HK: Curr Opin Cell Biol : Tashiro K, Sephel GC et al.: J Biol Chem : Nomizu M, Yamamura K et al.: Cancer Res : Tuszynski GP, Rothman VL et al.: J Cell Biol : Beck K, Hunter I et al.: FASEB J : Kijimoto-Ochiai S, Noguchi A: Biochem Biophys Res Commun : Main AL, Harvey TS et al.: Cell : Leahy DJ, Hendrickson WA et al.: Science : Bilozur ME, Hay ED: Dev Biol : Dr. Krkos Károly V

9 56. Vandenberg P, Kern A et al.: J Cell Biol : Joseph DR, Baker ME: SASEB J : Iwamoto Y, Robey FA et al.: Science : Stack S, Gray RD et al.: Biochemistry : Minguel JJ, Hardy CI et al.: Biochem Biophys Acta : Aota S Nagai T et al.: J Biol Chem : Hadley MA, Weeks BS et al.: Dev Biol : Phillips DR, Charo IF et al.: Cell : Mizejewski GJ: Proc Soc Exp Biol Med : Mizejewski GJ, Vonnegut V et al.: Proc. Natl. Acad. Sci USA : Nashihira J, Koyama Y et al.: Biochem Biophys Res Commun : Taketa K: Electrophoresis : Smith CJ, Kelleher PC et al.: Br Med J : Rouslahti E, Engvall E et al.: Int J Cancer : Ishiguro T, Sakaguchi H et al.: Am J Reprod Immunol : Ohta M, Kawahara N et al.: Acta Med Okayama : Breborowitz J, Mackiewicz A et al.: Scand J Immunol : Kumada T, Nakano I et al.: J Hepatol : Parmelee DC, Evensen MA et al.: J Biol Chem : Barde CB, Nagai M et al.: J Biol Chem : Leal JA, Eddy KB et al.: Anal Biochem : Zizkovsky V, Strop P et al.: Ann NY Acad Sci : Uversky NV, Kirkitadze MD et al.: FEBS Lett : Uversky NV, Narizhneva NV et al.: Biochemistry : Dudich IV, Semenkova LN et al.: Tumor Biol : Demarest ST, Boice JA et al.: J Mol Biol : Greene LH, Grobler JA et al.: Protein Eng : Demarest SJ, Raleigh DP: Protein Struct Func Gen : Griko YV, Remeta DP: Protein Sci : Uversky VN, Narizhneva NV et al.: Fold Design : Mathews BW: FASEB J : Wang C, Lascu I et al.: Biochemistry : Dockal M, Carter DC et al.: J Biol Chem : Bychkova VE, Dujsekina AE et al.: Biochemistry : Kindu B, Guptasarma P: Protein Struct Func Gen : Van der Groot FG, Gonzales-Manas JM et al.: Nature : Ptitsyn OB, Bychkova VE et al.: Phil Trans Roy Soc (Lond-B) : Eilers M, Hwang S, Schatz G: EMBO J : Uversky VN, Ptitsyn OB: Fold Design : Thomasson WA: Fed Am Soc Exp Biol, Bethesda, MD Vol 1 (Suppl), pp Buchner J: FASEB J : Caplan AJ: Trends Cell Biol : Lorimer GH: FASEB J : Ellis RJ, Hartl FV: FASEB J : Shortle D: FASEB J : Kronquist KE, Dreazen E et al.: Prenat Diag : Rumble B, Retallock R et al.: NEJM : Perez N, Sugar J et al.: Mol Brain Res : Liautard JP: Med. Hypothesis : Ananthan J, Goldberg AL et al.: Science : Sotnichenko AI, Severin SE et al.: FEBS Lett : Wang XW, Xie H: Int J Cancer : Greenberg F, Faucett A et al.: Am J Obstet Gynecol : Gershwin NME, Castles JJ et al.: J Natl Cancer Inst : Mizejewski GJ: Clin Immunol Newslett : Mizejewski GJ, Jacobson HI: In: Mizejewski GJ, Jacobson HI, Eds, Biological Activities of Alpha- Fetoprotein, Boca Raton, FL, CRC Press. Vol 1: pp 71-82, 1987 Dr. Krkos Károly V

10 112. Mizejewski GJ, Warner AS: J Reprod Fertil : Mizejewski GJ, Keenan JF et al.: Biol Reprod : Leffert HI, Sell S: J Cell Biol : Toder V, Bland M et al.: Placenta : Hamel S, Hoskin DW: In: Mizejewski GJ, Jacobson HI, Eds, Biological Activities of Alpha- Fetoprotein, Boca Raton, FL, CRC Press. Vol 1: pp , Leal JA, May JV et al.: Endocrinology : Keel BA, Eddy KB et al.: Endocrinology : Jacobson HI, Bennett JA, Mizejewski GJ: Cancer Res : Semenkova LN, Dudich EI: Tumor Biol : Semenkova LN, Dudich EI: Tumor Biol : Semenkova LN, Dudich EI: Eur Cytokin Network : Dudich I, Dudich E et al.: Eur Cytokin Network : Dudich E, Semenkova L et al.: Eur Cytokin Network : Dudich E, Semenkova L et al.: J Interferon Cytokine Res : Dudich E, Semenkova L et al.: Tumor Biol : Goncharova O, Dudich E et al.: Tumor Biol (S2): Bennett JA, Zhu S et al.: Clin Cancer Res : Nishi S, Matsue H et al.: Proc. Natl. Acad. Sci USA : Nishi S, Shahbazzadeh D et al.: Tumor Biol : Penque D, Mendes F et al.: Lab Invest : Wald NJ, Cuckle HS et al.: BMJ : Palomaki GE, Knight GJ et al.: Am J Obstet Gynecol : Wald NJ, Kennard A et al.: J Med Screen Bartles I, Hoppe-Sievert B et al.: Prenat Diagn (2): Sancken U, Bartels I: Prenat Diagn : Canick JA, Rish S Prenat Diagn : Wald NJ, Huttly W: Prenat Diagn : Onda T, Tanaka T et al.: Prenat Diagn : Wald NJ, Kennard A: Prenatal screening for neural tube defects and Down s syndrome in: Rimoin DL, Connor JM and Pyseritz RE eds. Emery and Rimoin s principles and practice of medical genetics. 3 rd ed. Edinburgh: Churchill Livingstone, 1996: Wald LJ, Cuckle H et al.: Lancet, 1977; i: Bond EB, Thumpson W et al.: BJOG (8): Muller F: Child s Nervous System 19(7-8): Wald LJ, Cuckle H et al.: Prenat Diagn : Buamah PK, Skillen AW et al.: Clin Chem (4): Sancken U, Bartels I et al.: Prenat Diagn (10): Dr. Krkos Károly V

DOWN-KÓR INTRAUTERIN SZŰRÉSI LEHETŐSÉGEI. 2013 szeptemberi MLDT-tagozati ülésen elhangzottak

DOWN-KÓR INTRAUTERIN SZŰRÉSI LEHETŐSÉGEI. 2013 szeptemberi MLDT-tagozati ülésen elhangzottak DOWN-KÓR INTRAUTERIN SZŰRÉSI LEHETŐSÉGEI 2013 szeptemberi MLDT-tagozati ülésen elhangzottak 21-es triszómia: Mi az a Down kór Down-kór gyakorisága: 0,13% Anya életkora (év) 20 25 30 35 40 45 49 Down-kór


A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei

A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A keringı tumor markerek klinikai alkalmazásának aktuális kérdései és irányelvei A TM vizsgálatok alapkérdései A vizsgálatok célja, információértéke? Az alkalmazás területei? Hogyan válasszuk ki az alkalmazott


Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 3. előadás Az immunrendszer molekuláris elemei: antigén, ellenanyag, Ig osztályok Az antigén meghatározása Detre László: antitest generátor - Régi meghatározás:


Natív antigének felismerése. B sejt receptorok, immunglobulinok

Natív antigének felismerése. B sejt receptorok, immunglobulinok Natív antigének felismerése B sejt receptorok, immunglobulinok B és T sejt receptorok A B és T sejt receptorok is az immunglobulin fehérje család tagjai A TCR nem ismeri fel az antigéneket, kizárólag az


METASZTÁZISKÉPZÉS. Láng Orsolya. Kemotaxis speciálkollégium 2005.

METASZTÁZISKÉPZÉS. Láng Orsolya. Kemotaxis speciálkollégium 2005. METASZTÁZISKÉPZÉS Láng Orsolya Kemotaxis speciálkollégium 2005. TUMOROK ÉS MIGRÁCIÓ PRIMER TUMOR METASZTÁZIS Angiogenezis Adhézió SEJT - SEJTCIKLUS Apoptózis Kemokinek Növekedési faktorok Szabályozó fehérjék


Az Oxidatív stressz hatása a PIBF receptor alegységek összeszerelődésére.

Az Oxidatív stressz hatása a PIBF receptor alegységek összeszerelődésére. Újabban világossá vált, hogy a Progesterone-induced blocking factor (PIBF) amely a progesteron számos immunológiai hatását közvetíti, nem csupán a lymphocytákban és terhességgel asszociált szövetekben,


Prenatalis diagnosztika lehetőségei mikor, hogyan, miért? Dr. Almássy Zsuzsanna Heim Pál Kórház, Budapest Toxikológia és Anyagcsere Osztály

Prenatalis diagnosztika lehetőségei mikor, hogyan, miért? Dr. Almássy Zsuzsanna Heim Pál Kórház, Budapest Toxikológia és Anyagcsere Osztály Prenatalis diagnosztika lehetőségei mikor, hogyan, miért? Dr. Almássy Zsuzsanna Heim Pál Kórház, Budapest Toxikológia és Anyagcsere Osztály Definíció A prenatális diagnosztika a klinikai genetika azon


Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás.

Immunológia alapjai előadás MHC. szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Antigén felismerés Az ellenanyagok és a B sejt receptorok natív formában


Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői.

Immunológia alapjai előadás. Az immunológiai felismerés molekuláris összetevői. Immunológia alapjai 3 4. előadás Az immunológiai felismerés molekuláris összetevői. Az antigén fogalma. Antitestek, T- és B- sejt receptorok: molekuláris szerkezet, funkciók, alcsoportok Az antigén meghatározása


Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás.

Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Immunológia alapjai 5-6. előadás MHC szerkezete és genetikája, és az immunológiai felismerésben játszott szerepe. Antigén bemutatás. Az immunrendszer felépítése Veleszületett immunitás (komplement, antibakteriális


http://www.rimm.dote.hu Tumor immunológia

http://www.rimm.dote.hu Tumor immunológia http://www.rimm.dote.hu Tumor immunológia A tumorok és az immunrendszer kapcsolatai Tumorspecifikus és tumorasszociált antigének A tumor sejteket ölő sejtek és mechanizmusok Az immunológiai felügyelet


Diabéteszes redox változások hatása a stresszfehérjékre

Diabéteszes redox változások hatása a stresszfehérjékre Semmelweis Egyetem Molekuláris Orvostudományok Tudományági Doktori Iskola Pathobiokémia Program Doktori (Ph.D.) értekezés Diabéteszes redox változások hatása a stresszfehérjékre dr. Nardai Gábor Témavezeto:


II./3.3.2 fejezet:. A daganatok célzott kezelése

II./3.3.2 fejezet:. A daganatok célzott kezelése II./3.3.2 fejezet:. A daganatok célzott kezelése Kopper László A fejezet célja, hogy megismerje a hallgató a célzott terápiák lehetőségeit és a fejlesztés lényeges lépéseit. A fejezet teljesítését követően


Fehérjeglikoziláció az endoplazmás retikulumban mint lehetséges daganatellenes támadáspont

Fehérjeglikoziláció az endoplazmás retikulumban mint lehetséges daganatellenes támadáspont Fehérjeglikoziláció az endoplazmás retikulumban mint lehetséges daganatellenes támadáspont Doktori tézisek Dr. Konta Laura Éva Semmelweis Egyetem Molekuláris Orvostudományok Tudományági Doktori Iskola





6. Zárványtestek feldolgozása

6. Zárványtestek feldolgozása 6. Zárványtestek feldolgozása... 1 6.1. A zárványtestek... 1 6.1.1. A zárványtestek kialakulása... 2 6.1.2. A feldolgozási technológia... 3 Sejtfeltárás... 3 Centrifugálás, tisztítás...


A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban

A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban A humán tripszinogén 4 expressziója és eloszlási mintázata az emberi agyban Doktori (PhD) értekezés Siklódi Erika Rozália Biológia Doktori Iskola Iskolavezető: Prof. Erdei Anna, tanszékvezető egyetemi


9. előadás Sejtek közötti kommunikáció

9. előadás Sejtek közötti kommunikáció 9. előadás Sejtek közötti kommunikáció Intracelluláris kommunikáció: Elmozdulás aktin szálak mentén miozin segítségével: A mikrofilamentum rögzített, A miozin mozgékony, vándorol az aktinmikrofilamentum



TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL TRIPSZIN TISZTÍTÁSA AFFINITÁS KROMATOGRÁFIA SEGÍTSÉGÉVEL Az egyes biomolekulák izolálása kulcsfontosságú a biológiai szerepük tisztázásához. Az affinitás kromatográfia egyszerűsége, reprodukálhatósága


A kemotaxis kiváltására specializálódott molekula-család: Cytokinek

A kemotaxis kiváltására specializálódott molekula-család: Cytokinek A kemotaxis kiváltására specializálódott molekula-család: Cytokinek Cytokinek - definíció Cytokin (Cohen 1974): Sejtek közötti kémi miai kommunikációra alkalmas anyagok; legtöbbjük növekedési vagy differenciációs


Kalcium, D-vitamin és a daganatok

Kalcium, D-vitamin és a daganatok Kalcium, D-vitamin és a daganatok dr. Takács István SE ÁOK I.sz. Belgyógyászati Klinika Napi kalcium vesztés 200 mg (16% aktív transzport mellett ez 1000 mg bevitelnek felel meg) Emilianii huxley Immun



POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK POSZTTRANSZLÁCIÓS MÓDOSÍTÁSOK: GLIKOZILÁLÁSOK Dr. Pécs Miklós Budapesti Műszaki és Gazdaságtudományi Egyetem, Alkalmazott Biotechnológia és Élelmiszertudomány Tanszék 1 Glikozilálás A rekombináns fehérjék


a legérzékenyebb markerkombináció emlôdaganatoknál

a legérzékenyebb markerkombináció emlôdaganatoknál TPA és CA 15-3 a legérzékenyebb markerkombináció emlôdaganatoknál Bevezetés Az emlôrák a leggyakoribb rosszindulatú betegség nôknél. Elôfordulásának gyakorisága 100.000 személybôl átlagosan 60 eset (1)


A sejtek közötti közvetett (indirekt) kapcsolatok

A sejtek közötti közvetett (indirekt) kapcsolatok A sejtek közötti közvetett (indirekt) kapcsolatok kémiai anyag közvetítése a jeladó - jel - csatorna - jelfogó rendszerben szöveti hormon hormon szövet közötti tér véráram neurotranszmisszió neurotranszmitter


Nem-konjugált ösztriol (szabad ösztriol, ue3)

Nem-konjugált ösztriol (szabad ösztriol, ue3) Nem-konjugált ösztriol (szabad ösztriol, ue3) Biokémia és élettani adatok Az ösztriol [ösztra-1, 3, 5, (10)-trién-3, 16α, 17β-triol], mely a vizelet legfőbb ösztrogénje, biológiai aktivitása kisebb az


A DOWN-KÓR SZŰRÉSE. Down-kór szűrés az egészséges babákért és a boldog kismamákért. Mi az a Down szindróma? A Down szindróma tünetei:

A DOWN-KÓR SZŰRÉSE. Down-kór szűrés az egészséges babákért és a boldog kismamákért. Mi az a Down szindróma? A Down szindróma tünetei: A DOWN-KÓR SZŰRÉSE Kedves Kismama! Gratulálunk születendő gyermekéhez! Ön és családja bizonyára örömmel várják az újszülött érkezését, azonban a legtöbb kismamához hasonlóan Önben is felmerül, hogy a szülés


Receptorok és szignalizációs mechanizmusok

Receptorok és szignalizációs mechanizmusok Molekuláris sejtbiológia: Receptorok és szignalizációs mechanizmusok Dr. habil Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immunbiológiai Intézet Sejtek szignalizációs kapcsolatai Sejtek szignalizációs


Riboszóma. Golgi. Molekuláris sejtbiológia

Riboszóma. Golgi. Molekuláris sejtbiológia Molekuláris sejtbiológia d-er Riboszóma Golgi Dr. habil KŐHIDAI László egyetemi docens Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet 2005. október 27. Endoplamatikus = sejten belüli; retikulum


A citoszol szolubilis fehérjéi. A citoplazma matrix (citoszol) Caspase /Kaszpáz/ 1. Enzimek. - Organellumok nélküli citoplazma

A citoszol szolubilis fehérjéi. A citoplazma matrix (citoszol) Caspase /Kaszpáz/ 1. Enzimek. - Organellumok nélküli citoplazma A citoplazma matrix (citoszol) A citoszol szolubilis fehérjéi 1. Enzimek - Organellumok nélküli citoplazma -A sejt fejlődéstani szempontból legősibb része (a sejthártyával együtt) Glikolízis teljes enzimrendszere


A MASP-1 dózis-függő módon vazorelaxációt. okoz egér aortában

A MASP-1 dózis-függő módon vazorelaxációt. okoz egér aortában Analog input Analog input 157.34272 167.83224 178.32175 188.81127 Relaxáció (prekontrakció %) Channel 8 Channel 8 Analog input Volts Volts Channel 12 A dózis-függő módon vazorelaxációt Vehikulum 15.80


A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai

A tananyag felépítése: A BIOLÓGIA ALAPJAI. I. Prokarióták és eukarióták. Az eukarióta sejt. Pécs Miklós: A biológia alapjai A BIOLÓGIA ALAPJAI A tananyag felépítése: Környezetmérnök és műszaki menedzser hallgatók számára Előadó: 2 + 0 + 0 óra, félévközi számonkérés 3 ZH: október 3, november 5, december 5 dr. Pécs Miklós egyetemi


Új könnyűlánc diagnosztika. Dr. Németh Julianna Országos Gyógyintézeti Központ Immundiagnosztikai Osztály MLDT-MIT Továbbképzés 2006

Új könnyűlánc diagnosztika. Dr. Németh Julianna Országos Gyógyintézeti Központ Immundiagnosztikai Osztály MLDT-MIT Továbbképzés 2006 Új könnyűlánc diagnosztika Dr. Németh Julianna Országos Gyógyintézeti Központ Immundiagnosztikai Osztály MLDT-MIT Továbbképzés 2006 1845 Bence Jones Protein vizelet fehérje 1922 BJP I-II típus 1956 BJP


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi


Fehérjeszerkezet, fehérjetekeredés

Fehérjeszerkezet, fehérjetekeredés Fehérjeszerkezet, fehérjetekeredés A fehérjeszerkezet szintjei A fehérjetekeredés elmélete: Anfinsen kísérlet Levinthal paradoxon A feltekeredés tölcsér elmélet 2014.11.05. Aminosavak és fehérjeszerkezet


A zsírszövet mellett az agyvelő lipidekben leggazdagabb szervünk. Pontosabban az agy igen gazdag hosszú szénláncú politelítetlen zsírsavakban

A zsírszövet mellett az agyvelő lipidekben leggazdagabb szervünk. Pontosabban az agy igen gazdag hosszú szénláncú politelítetlen zsírsavakban BEVEZETÉS ÉS A KUTATÁS CÉLJA A zsírszövet mellett az agyvelő lipidekben leggazdagabb szervünk. Pontosabban az agy igen gazdag hosszú szénláncú politelítetlen zsírsavakban (LCPUFA), mint az arachidonsav


Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből.

Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Vércukorszint szabályozása: Szénhidrátok monoszacharidok formájában szívódnak fel a vékonybélből. Szövetekben monoszacharid átalakítás enzimjei: Szénhidrát anyagcserében máj központi szerepű. Szénhidrát


Az AT 1A -angiotenzinreceptor G-fehérjétől független jelátvitelének vizsgálata C9 sejtekben. Doktori tézisek. Dr. Szidonya László

Az AT 1A -angiotenzinreceptor G-fehérjétől független jelátvitelének vizsgálata C9 sejtekben. Doktori tézisek. Dr. Szidonya László Az AT 1A -angiotenzinreceptor G-fehérjétől független jelátvitelének vizsgálata C9 sejtekben Doktori tézisek Dr. Szidonya László Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola Témavezető:


Immunológia I. 4. előadás. Kacskovics Imre

Immunológia I. 4. előadás. Kacskovics Imre Immunológia I. 4. előadás Kacskovics Imre (imre.kacskovics@ttk.elte.hu) 3.1. ábra A vérsejtek képződésének helyszínei az élet folyamán 3.2. ábra A hemopoetikus őssejt aszimmetrikus osztódása 3.3. ábra


1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói

1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói 1. előadás Membránok felépítése, mebrán raftok, caveolák jellemzője, funkciói Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis


A polipeptidlánc szabályozott lebontása: mit mondanak a fehérjekristályok? Harmat Veronika ELTE Kémiai Intézet, Szerkezeti Kémia és Biológia Laboratórium MTA-ELTE Fehérjemodellező Kutatócsoport A magyar


MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav,

MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, MULTICELLULÁRIS SZERVEZŐDÉS: SEJT-SEJT (SEJT-MÁTRIX) KÖLCSÖNHATÁSOK 1. Bevezetés (2.)Extracelluláris mátrix (ECM) (Kollagén, hialuron sav, proteoglikánok) (3.)Multiadhéziós fehérjék és sejtfelszíni receptorok


Hús és hústermék, mint funkcionális élelmiszer

Hús és hústermék, mint funkcionális élelmiszer Hús és hústermék, mint funkcionális élelmiszer Szilvássy Z., Jávor A., Czeglédi L., Csiki Z., Csernus B. Debreceni Egyetem Funkcionális élelmiszer Első használat: 1984, Japán speciális összetevő feldúsítása


NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A

NÖVÉNYGENETIKA. Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP /1/A NÖVÉNYGENETIKA Az Agrármérnöki MSc szak tananyagfejlesztése TÁMOP-4.1.2-08/1/A-2009-0010 A NÖVÉNYI TÁPANYAG TRANSZPORTEREK az előadás áttekintése A tápionok útja a növényben Növényi tápionok passzív és


Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet

Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét. Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás és adhézió Molekuláris biológia kurzus 8. hét Kun Lídia Genetikai, Sejt és Immunbiológiai Intézet Sejtmozgás -amőboid - csillós - kontrakció Sejt adhézió -sejt-ecm -sejt-sejt MOZGÁS A sejtmozgás


A sejtek közötti közvetett (indirekt) kapcsolatok

A sejtek közötti közvetett (indirekt) kapcsolatok A sejtek közötti közvetett (indirekt) kapcsolatok kémiai anyag közvetítése a jeladó - jel - csatorna - jelfogó rendszerben szöveti hormon hormon szövet közötti tér véráram neurotranszmisszió neurotranszmitter


Vezikuláris transzport

Vezikuláris transzport Molekuláris Sejtbiológia Vezikuláris transzport Dr. habil KŐHIDAI László Semmelweis Egyetem, Genetikai, Sejt- és Immunbiológiai Intézet 2005. november 3. Intracelluláris vezikul uláris transzport Kommunikáció


Esetbemutatás. Dr. Iván Mária Uzsoki Kórház 2013.11.07.

Esetbemutatás. Dr. Iván Mária Uzsoki Kórház 2013.11.07. Esetbemutatás Dr. Iván Mária Uzsoki Kórház 2013.11.07. Esetbemutatás I. 26 éves férfi 6 héttel korábban bal oldali herében elváltozást észlelt,majd 3 héttel később haemoptoe miatt kereste fel orvosát antibiotikumos


VÁLASZ. Dr. Virág László bírálatára

VÁLASZ. Dr. Virág László bírálatára VÁLASZ Dr. Virág László bírálatára Köszönöm, hogy Professzor úr vállalta értekezésem bírálatát. Hálás vagyok az értékelésében foglalt méltató szavakért, és a disszertáció vitára bocsátásának támogatásáért.


FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest,

FEHÉRJÉK A MÁGNESEKBEN. Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium. Alkímia Ma, Budapest, FEHÉRJÉK A MÁGNESEKBEN Bodor Andrea ELTE, Szerkezeti Kémiai és Biológiai Laboratórium Alkímia Ma, Budapest, 2013.02.28. I. FEHÉRJÉK: L-α aminosavakból felépülő lineáris polimerek α H 2 N CH COOH amino


Kutatási beszámoló ( )

Kutatási beszámoló ( ) Kutatási beszámoló (2008-2012) A thrombocyták aktivációja alapvető jelentőségű a thrombotikus betegségek kialakulása szempontjából. A pályázat során ezen aktivációs folyamatok mechanizmusait vizsgáltuk.


3. Sejtalkotó molekulák III.

3. Sejtalkotó molekulák III. 3. Sejtalkotó molekulák III. Fehérjék, fehérjeszintézis (transzkripció, transzláció, posztszintetikus módosítások). Enzimműködés 3.1 Fehérjék A genetikai információ egyik fő manifesztálódása Számos funkció


TDK lehetőségek az MTA TTK Enzimológiai Intézetben

TDK lehetőségek az MTA TTK Enzimológiai Intézetben TDK lehetőségek az MTA TTK Enzimológiai Intézetben Vértessy G. Beáta egyetemi tanár TDK mind 1-3 helyezettek OTDK Pro Scientia különdíj 1 második díj Diákjaink Eredményei Zsűri különdíj 2 első díj OTDK


Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45

Élettan. előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 Élettan előadás tárgykód: bf1c1b10 ELTE TTK, fizika BSc félév: 2015/2016., I. időpont: csütörtök, 8:15 9:45 oktató: Dr. Tóth Attila, adjunktus ELTE TTK Biológiai Intézet, Élettani és Neurobiológiai tanszék


Bevezetés. A fejezet felépítése

Bevezetés. A fejezet felépítése II./3.8. fejezet: Szervátültetés kérdése daganatos betegségek esetén Langer Róbert, Végső Gyula, Horkay Ferenc, Fehérvári Imre A fejezet célja, hogy a hallgatók megismerkedjenek a szervátültetés és a daganatos


CzB 2010. Élettan: a sejt

CzB 2010. Élettan: a sejt CzB 2010. Élettan: a sejt Sejt - az élet alapvető egysége Prokaryota -egysejtű -nincs sejtmag -nincsenek sejtszervecskék -DNS = egy gyűrű - pl., bactériumok Eukaryota -egy-/többsejtű -sejmag membránnal


Újabb ismeretek a Graves-ophthalmopathia kórisméjében

Újabb ismeretek a Graves-ophthalmopathia kórisméjében Újabb ismeretek a Graves-ophthalmopathia kórisméjében Dr. Molnár Ildikó 2004 Tézisek Az utóbbi 11 évben végzett tudományos munkám új eredményei 1. Graves-kórhoz társult infiltratív ophthalmopathia kialakulásában


K68464 OTKA pályázat szakmai zárójelentés

K68464 OTKA pályázat szakmai zárójelentés K68464 OTKA pályázat szakmai zárójelentés A fehérjeaggregáció és amiloidképződés szerkezeti alapjai; a különféle morfológiájú aggregátumok kialakulásának körülményei és in vivo hatásuk vizsgálata Vezető


2016. nov. 8. Bajtay Zsuzsa

2016. nov. 8. Bajtay Zsuzsa 6. Komplementreceptorok fajtái és szerepük az immunválasz során 2016. nov. 8. Bajtay Zsuzsa A komplementrendszer - Vérben, testnedvekben inaktív állapotban jelenlévő - egymást láncreakcióban aktiváló faktorok


ZSÍRSAVAK OXIDÁCIÓJA. FRANZ KNOOP német biokémikus írta le először a mechanizmusát. R C ~S KoA. a, R-COOH + ATP + KoA R C ~S KoA + AMP + PP i

ZSÍRSAVAK OXIDÁCIÓJA. FRANZ KNOOP német biokémikus írta le először a mechanizmusát. R C ~S KoA. a, R-COOH + ATP + KoA R C ~S KoA + AMP + PP i máj, vese, szív, vázizom ZSÍRSAVAK XIDÁCIÓJA FRANZ KNP német biokémikus írta le először a mechanizmusát 1 lépés: a zsírsavak aktivációja ( a sejt citoplazmájában, rövid zsírsavak < C12 nem aktiválódnak)


A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin.

A fehérjék szerkezeti hierarchiája. Fehérje-szerkezetek! Klasszikus szerkezet-funkció paradigma. szekvencia. funkció. szerkezet! Myoglobin. Myoglobin Fehérje-szerkezetek! MGLSDGEWQLVLNVWGKVEADIPGGQEVLIRLFK GPETLEKFDKFKLKSEDEMKASE DLKKGATVLTALGGILKKKGEAEIKPLAQSA TKKIPVKYLEFISECIIQVLQSK PGDFGADAQGAMNKALELFRKDMASNYKELGFQG Fuxreiter Mónika! Debreceni



A CSONTPÓTLÓ MŰTÉTEK BIOLÓGIAI ALAPJAI, A JÖVŐ LEHETŐSÉGEI Semmelweis Egyetem Arc- Állcsont- Szájsebészeti- és Fogászati Klinika Igazgató: Prof. Németh Zsolt A CSONTPÓTLÓ MŰTÉTEK BIOLÓGIAI ALAPJAI, A JÖVŐ LEHETŐSÉGEI Dr. Barabás Péter, Dr. Huszár Tamás SE Szak-


1. Előadás Membránok felépítése, mebrán raftok

1. Előadás Membránok felépítése, mebrán raftok 1. Előadás Membránok felépítése, mebrán raftok Plazmamembrán Membrán funkciói: sejt integritásának fenntartása állandó hő, energia, és információcsere biztosítása homeosztázis biztosítása Klasszikus folyadékmozaik


Autoan'testek vizsgáló módszerei, HLA 'pizálás. Immunológiai és Biotechnológiai Intézet PTE- ÁOK

Autoan'testek vizsgáló módszerei, HLA 'pizálás. Immunológiai és Biotechnológiai Intézet PTE- ÁOK Autoan'testek vizsgáló módszerei, HLA 'pizálás Immunológiai és Biotechnológiai Intézet PTE- ÁOK Természetes autoan'testek Pathológiás autoan'testek Természetes autoan'testek IgM Alacsony affinitás Alacsony


Immunológiai módszerek a klinikai kutatásban

Immunológiai módszerek a klinikai kutatásban Immunológiai módszerek a klinikai kutatásban 7. előadás Immunizálás. Poliklonális és monoklonális ellenanyag előállítása, tisztítása, alkalmazása Az antigén (haptén + hordozó) sokféle specificitású ellenanyag


Fehérje O-Glikoziláció (O-GlcNAc) szerepe különböző betegségekben, detektálási lehetőségei

Fehérje O-Glikoziláció (O-GlcNAc) szerepe különböző betegségekben, detektálási lehetőségei Fehérje O-Glikoziláció (O-GlcNAc) szerepe különböző betegségekben, detektálási lehetőségei Nagy T., Frank D., Miseta A., Kovács GL. Laboratóriumi Medicina Intézet, ÁOK, Pécsi Tudományegyetem, Pécs 2010


A Globális regulátor mutációknak mint az attenuálás lehetőségének vizsgálata Escherichia coli-ban

A Globális regulátor mutációknak mint az attenuálás lehetőségének vizsgálata Escherichia coli-ban A Globális regulátor mutációknak mint az attenuálás lehetőségének vizsgálata Escherichia coli-ban című támogatott kutatás fő célja az volt, hogy olyan regulációs mechanizmusoknak a virulenciára kifejtett


kutatás során legfőbb eredményeinket a szerin proteázok aktiválódásának mechanizmusával és az aktiválódás fiziológiai következményeinek

kutatás során legfőbb eredményeinket a szerin proteázok aktiválódásának mechanizmusával és az aktiválódás fiziológiai következményeinek Fehérjék konformációs flexibilitása mint a biomolekuláris felismerés és a jeltovábbítás alapvető eleme (OTKA NK 77978) Zárójelentés (2009. ápr. 1-től 2013. márc. 31-ig) A biológiai rendszerek önszerveződésének


Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen

Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Az orvosi biotechnológiai mesterképzés megfeleltetése az Európai Unió új társadalmi kihívásainak a Pécsi Tudományegyetemen és a Debreceni Egyetemen Azonosító szám: TÁMOP-4.1.2-08/1/A-2009-0011 Az orvosi





Stresszfehérjék (hősokk fehérjék)

Stresszfehérjék (hősokk fehérjék) Stresszfehérjék (hősokk fehérjék) Ama különféle fehérjék összefoglaló elnevezése, amelyeket az élő sejtek a megemelkedett hőmérsékletre (a hősokkra) válaszul fokozott mértékben termelnek. A hősokk-fehérjék


I./5. fejezet: Daganatok növekedése és terjedése

I./5. fejezet: Daganatok növekedése és terjedése I./5. fejezet: Daganatok növekedése és terjedése Tímár József A fejezet célja, hogy a hallgató megismerje a daganatok növekedésének és biológiai viselkedésének alapjait. A fejezet teljesítését követően


Sejtadhézió. Sejtkapcsoló struktúrák

Sejtadhézió. Sejtkapcsoló struktúrák Sejtadhézió Sejtkapcsoló struktúrák Sejtadhézió jelentősége: Sejtlemezek kialakulása Sejtadhézió jelentősége: Többrétegű sejtsorok kialakulása Limfociták kilépése az endotélen Rolling Adhézió Belépés homing


A tüdő adenocarcinomák szubklasszifikációja. Dr. Szőke János Molekuláris Patológiai Osztály Budapest, 2008 december 5.

A tüdő adenocarcinomák szubklasszifikációja. Dr. Szőke János Molekuláris Patológiai Osztály Budapest, 2008 december 5. A tüdő adenocarcinomák szubklasszifikációja Dr. Szőke János Molekuláris Patológiai Osztály Budapest, 2008 december 5. Háttér A tüdő ACA heterogén tumor csoport és a jelenlegi klasszifikáció elsősorban


Az adiponektin és az omentin-1 összefüggéseinek vizsgálata elhízott, nem cukorbeteg egyénekben

Az adiponektin és az omentin-1 összefüggéseinek vizsgálata elhízott, nem cukorbeteg egyénekben Az adiponektin és az omentin-1 összefüggéseinek vizsgálata elhízott, nem cukorbeteg egyénekben Bortély Blanka ÁOK V. Debreceni Egyetem Általános Orvostudományi Kar Belgyógyászati Intézet A épület Témavezető:


Az agy betegségeinek molekuláris biológiája. 1. Prion betegség 2. Trinukleotid ripít betegségek 3. ALS 4. Parkinson kór 5.

Az agy betegségeinek molekuláris biológiája. 1. Prion betegség 2. Trinukleotid ripít betegségek 3. ALS 4. Parkinson kór 5. Az agy betegségeinek molekuláris biológiája 1. Prion betegség 2. Trinukleotid ripít betegségek 3. ALS 4. Parkinson kór 5. Alzheimer kór 28 Prion betegség A prion betegség fertőző formáját nem egy genetikai


DNS replikáció. DNS RNS Polipeptid Amino terminus. Karboxi terminus. Templát szál

DNS replikáció. DNS RNS Polipeptid Amino terminus. Karboxi terminus. Templát szál DNS replikáció DNS RNS Polipeptid Amino terminus Templát szál Karboxi terminus Szuper-csavarodott prokarióta cirkuláris DNS Hisztonok komplexe DNS hisztonokra történő felcsvarodása Hiszton-kötött negatív


17.2. ábra Az immunválasz kialakulása és lezajlása patogén hatására

17.2. ábra Az immunválasz kialakulása és lezajlása patogén hatására 11. 2016. nov 30. 17.2. ábra Az immunválasz kialakulása és lezajlása patogén hatására 17.3. ábra A sejtközötti térben és a sejten belül élő és szaporodó kórokozók ellen kialakuló védekezési mechanizmusok


A metabolikus szindróma genetikai háttere. Kappelmayer János, Balogh István (www.kbmpi.hu)

A metabolikus szindróma genetikai háttere. Kappelmayer János, Balogh István (www.kbmpi.hu) A metabolikus szindróma genetikai háttere Kappelmayer János, Balogh István (www.kbmpi.hu) Definíció WHO, 1999 EGIR, 1999 ATP III, 2001 Ha három vagy több komponens jelen van a betegben: Vérnyomás: > 135/85


Az endomembránrendszer részei.

Az endomembránrendszer részei. Az endomembránrendszer Szerkesztette: Vizkievicz András Az eukarióta sejtek prokarióta sejtektől megkülönböztető egyik alapvető sajátságuk a belső membránrendszerük. A belső membránrendszer szerkezete


B-sejtek szerepe az RA patológiás folyamataiban

B-sejtek szerepe az RA patológiás folyamataiban B-sejtek szerepe az RA patológiás folyamataiban Erdei Anna Biológiai Intézet Immunológiai Tanszék Eötvös Loránd Tudományegyetem Immunológiai Tanszék ORFI, Helia, 2015 április 17. RA kialakulása Gary S.


A KAR-2, egy antimitotikus ágens egyedi farmakológiájának atomi és molekuláris alapjai

A KAR-2, egy antimitotikus ágens egyedi farmakológiájának atomi és molekuláris alapjai A KAR-2, egy antimitotikus ágens egyedi farmakológiájának atomi és molekuláris alapjai A doktori értekezés tézisei Horváth István Eötvös Loránd Tudományegyetem Biológia Doktori Iskola (A Doktori Iskola


Poligénes v. kantitatív öröklődés

Poligénes v. kantitatív öröklődés 1. Öröklődés komplexebb sajátosságai 2. Öröklődés molekuláris alapja Poligénes v. kantitatív öröklődés Azok a tulajdonságokat amelyek mértékegységgel nem, vagy csak nehezen mérhetők, kialakulásuk kevéssé



AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE AZ ÉLET KÉMIÁJA... ÉLŐ ANYAG SZERVEZETI ALAPEGYSÉGE A biológia az élet tanulmányozásával foglalkozik, az élő szervezetekre viszont vonatkoznak a fizika és kémia törvényei MI ÉPÍTI FEL AZ ÉLŐ ANYAGOT? HOGYAN


Az Integrált-teszt. teszt összehasonlítása a jelenlegi terhesgondozás gyakorlatával

Az Integrált-teszt. teszt összehasonlítása a jelenlegi terhesgondozás gyakorlatával Az Integrált-teszt teszt összehasonlítása a jelenlegi terhesgondozás gyakorlatával Skriba Eszter /Állami Egészségügyi Központ/ Merhala Zoltán Timmermann Gábor /SE.II. Női Klinika/ Magzati Diagnosztikai


A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet.

A fehérjék harmadlagos vagy térszerkezete. Még a globuláris fehérjék térszerkezete is sokféle lehet. A fehérjék harmadlagos vagy térszerkezete Még a globuláris fehérjék térszerkezete is sokféle lehet. A ribonukleáz redukciója és denaturálódása Chrisian B. Anfinsen A ribonukleáz renaturálódása 1972 obel-díj


Fehérjeszerkezet, és tekeredés. Futó Kinga

Fehérjeszerkezet, és tekeredés. Futó Kinga Fehérjeszerkezet, és tekeredés Futó Kinga Polimerek Polimer: hasonló alegységekből (monomer) felépülő makromolekulák Alegységek száma: tipikusan 10 2-10 4 Titin: 3,435*10 4 aminosav C 132983 H 211861 N


Endocitózis - Exocitózis

Endocitózis - Exocitózis Molekuláris sejtbiológia Endocitózis - Exocitózis Dr. habil.. Kőhidai László Semmelweis Egyetem Genetikai, Sejt- és Immnubiológiai Intézet Budapest Endocitózis Fagocitózis szilárd fázishoz közel álló


Humán genom variációk single nucleotide polymorphism (SNP)

Humán genom variációk single nucleotide polymorphism (SNP) Humán genom variációk single nucleotide polymorphism (SNP) A genom ~ 97 %-a két különböző egyedben teljesen azonos ~ 1% különbség: SNP miatt ~2% különbség: kópiaszámbeli eltérés, deléciók miatt 11-12 millió


Biomolekuláris kölcsönhatások vizsgálata felületi plazmonrezonancia elvén működő Biacore keszülékkel

Biomolekuláris kölcsönhatások vizsgálata felületi plazmonrezonancia elvén működő Biacore keszülékkel Biomolekuláris kölcsönhatások vizsgálata felületi plazmonrezonancia elvén működő Biacore keszülékkel Biomolekuláris interakciók Fehérje-fehérje Fehérje-ligand Fehérje-DNS/RNS fehérje/ligand-lipid Alegység-kölcsönhatások,


2006 1. Nemszinaptikus receptorok és szubmikronos Ca2+ válaszok: A két-foton lézermikroszkópia felhasználása a farmakológiai vizsgálatokra.

2006 1. Nemszinaptikus receptorok és szubmikronos Ca2+ válaszok: A két-foton lézermikroszkópia felhasználása a farmakológiai vizsgálatokra. 2006 1. Nemszinaptikus receptorok és szubmikronos Ca 2+ válaszok: A két-foton lézermikroszkópia felhasználása a farmakológiai vizsgálatokra. A kutatócsoportunkban Közép Európában elsőként bevezetett két-foton


A negyedleges szerkezet szerepe a kis hő-sokk fehérjék

A negyedleges szerkezet szerepe a kis hő-sokk fehérjék A negyedleges szerkezet szerepe a kis hő-sokk fehérjék chaperon működésében Készítette: Böde Csaba Témavezető: Dr. Fidy Judit egyetemi tanár Semmelweis Egyetem Elméleti Orvostudományok Doktori Iskola Szigorlati





Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése

Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése Két kevéssé ismert humán ABCG fehérje expressziója és funkcionális vizsgálata: ABCG1 és ABCG4 jellemzése Doktori tézisek Dr. Cserepes Judit Semmelweis Egyetem Molekuláris Orvostudományok Doktori Iskola


Biomolekuláris nanotechnológia. Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium

Biomolekuláris nanotechnológia. Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium Biomolekuláris nanotechnológia Vonderviszt Ferenc PE MÜKKI Bio-Nanorendszerek Laboratórium Az élő szervezetek példája azt mutatja, hogy a fehérjék és nukleinsavak kiválóan alkalmasak önszerveződő molekuláris


DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY

DNS, RNS, Fehérjék. makromolekulák biofizikája. Biológiai makromolekulák. A makromolekulák TÖMEG szerinti mennyisége a sejtben NAGY makromolekulák biofizikája DNS, RNS, Fehérjék Kellermayer Miklós Tér Méret, alak, lokális és globális szerkezet Idő Fluktuációk, szerkezetváltozások, gombolyodás Kölcsönhatások Belső és külső kölcsöhatások,


Tumorbiológia Dr. Tóvári József (Országos Onkológiai Intézet)

Tumorbiológia Dr. Tóvári József (Országos Onkológiai Intézet) a Magyar Tudományos Akadémia Biológiai Osztály, Immunológiai Bizottsága és a Magyar Immunológiai Társaság Immunológia Világnapja - 2016 Tumorbiológia Dr. Tóvári József (Országos Onkológiai Intézet) Az


A sejtfelszíni receptorok három fő kategóriája

A sejtfelszíni receptorok három fő kategóriája A sejtfelszíni receptorok három fő kategóriája 1. Saját enzimaktivitás nélküli receptorok 1a. G proteinhez kapcsolt pl. adrenalin, szerotonin, glukagon, bradikinin receptorok 1b. Tirozin kinázhoz kapcsolt


Sav-bázis egyensúly. Dr. Miseta Attila

Sav-bázis egyensúly. Dr. Miseta Attila Sav-bázis egyensúly Dr. Miseta Attila A szervezet és a ph A ph egyensúly szorosan kontrollált A vérben a referencia tartomány: ph = 7.35 7.45 (35-45 nmol/l) < 6.8 vagy > 8.0 halálozáshoz vezet Acidózis


Vásárhelyi Barna. Semmelweis Egyetem, Laboratóriumi Medicina Intézet. Az ösztrogénekimmunmoduláns hatásai

Vásárhelyi Barna. Semmelweis Egyetem, Laboratóriumi Medicina Intézet. Az ösztrogénekimmunmoduláns hatásai Vásárhelyi Barna Semmelweis Egyetem, Laboratóriumi Medicina Intézet Az ösztrogénekimmunmoduláns hatásai Ösztrogénhatások Ösztrogénhatások Morbiditás és mortalitási profil eltérő nők és férfiak között Autoimmun


[ξ ] MTA KSZI mőhelytanulmányok 2009/1

[ξ ] MTA KSZI mőhelytanulmányok 2009/1 KSZI [ξ ] AKTÁK [ξ ] MTA KSZI mőhelytanulmányok 2009/1 http://www.mtakszi.hu/kszi_aktak/ Az MTA-osztályok felbontása bibliometriai szempontból: a Biológiai Tudományok Osztályának szerkezete (mintaadatbázisra
